[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55373.1
DDBJ      :             ribosomal protein L19
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->100 1vsaN PDBj 5e-28 51.0 %
:RPS:PDB   3->100 3bboR PDBj 1e-26 39.2 %
:RPS:SCOP  1->100 2j01T1  b.34.5.6 * 2e-32 50.0 %
:HMM:SCOP  1->114 2gyaN1 b.34.5.6 * 8.6e-41 61.4 %
:RPS:PFM   4->100 PF01245 * Ribosomal_L19 2e-26 63.9 %
:HMM:PFM   1->112 PF01245 * Ribosomal_L19 1.1e-49 58.0 112/113  
:BLT:SWISS 2->100 RL19_CLOD6 1e-37 70.7 %
:PROS 85->100|PS01015|RIBOSOMAL_L19
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55373.1 GT:GENE ACV55373.1 GT:PRODUCT ribosomal protein L19 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1677064..1677411 GB:FROM 1677064 GB:TO 1677411 GB:DIRECTION + GB:PRODUCT ribosomal protein L19 GB:NOTE TIGRFAM: ribosomal protein L19; PFAM: ribosomal protein L19; KEGG: bha:BH2478 50S ribosomal protein L19 GB:PROTEIN_ID ACV55373.1 GB:DB_XREF GI:257475053 InterPro:IPR001857 LENGTH 115 SQ:AASEQ MDIIRAIEQQQIKQDVPEFNVGDNVKVHYRITEGNRERIQVFQGDVIRRQGASNRETFTVRKISFSIGVERTFPVHSPKIERIEVVRQGDVRRAKLYYLRKKVGKAAKIKEKAYR GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 2->100|RL19_CLOD6|1e-37|70.7|99/116| PROS 85->100|PS01015|RIBOSOMAL_L19|PDOC00778| SEG 101->113|kkvgkaakikeka| BL:PDB:NREP 1 BL:PDB:REP 3->100|1vsaN|5e-28|51.0|98/137| RP:PDB:NREP 1 RP:PDB:REP 3->100|3bboR|1e-26|39.2|97/113| RP:PFM:NREP 1 RP:PFM:REP 4->100|PF01245|2e-26|63.9|97/112|Ribosomal_L19| HM:PFM:NREP 1 HM:PFM:REP 1->112|PF01245|1.1e-49|58.0|112/113|Ribosomal_L19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01245|IPR001857| GO:PFM GO:0005622|"GO:intracellular"|PF01245|IPR001857| GO:PFM GO:0005840|"GO:ribosome"|PF01245|IPR001857| GO:PFM GO:0006412|"GO:translation"|PF01245|IPR001857| RP:SCP:NREP 1 RP:SCP:REP 1->100|2j01T1|2e-32|50.0|100/137|b.34.5.6| HM:SCP:REP 1->114|2gyaN1|8.6e-41|61.4|114/0|b.34.5.6|1/1|Translation proteins SH3-like domain| OP:NHOMO 955 OP:NHOMOORG 923 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1111111111111111111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1112E1221-3253-51------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 86.1 SQ:SECSTR #HcTTHHHHTTccccccccccccccccccccccccccccccccccccccccccccccccccccccccTTTcccccccccccccccccccccccccccccc############### DISOP:02AL 115-116| PSIPRED cHHHHHHHHHHHHccccccccccEEEEEEEEEcccEEEEEEEEEEEEEEcccccccEEEEEEccccccEEEEEEcccccEEEEEEEEEEccHHHHHHHHHcccccHHHHHHHHcc //