[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55378.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55378.1 GT:GENE ACV55378.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1681596..1681862 GB:FROM 1681596 GB:TO 1681862 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: glo:Glov_2136 hypothetical protein GB:PROTEIN_ID ACV55378.1 GB:DB_XREF GI:257475058 LENGTH 88 SQ:AASEQ MTTLSMFYGIVIIMYNEADGRHHTPHIHAWFAEFECSIDFEGRVFDGRFPPRKLALLRAWIVLHQEELEADWKLMSEGLAAFRIDPLR GT:EXON 1|1-88:0| OP:NHOMO 33 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------2--------------------------------------------1-133---61-----------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------2---------------1-----------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------1--1----------111-3-----------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 88-89| PSIPRED ccHHHHHccEEEEEEEcccccccccEEEEEEcccEEEEEEcccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccccc //