[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55382.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:164 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   76->122 PF11766 * Candida_ALS_N 7.7e-05 23.4 47/249  
:HMM:PFM   13->51 PF06474 * MLTD_N 0.00011 21.1 38/95  
:HMM:PFM   47->89 PF11106 * YjbE 0.00084 41.9 43/80  
:BLT:SWISS 11->151 FLGH_CUPTR 4e-04 27.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55382.1 GT:GENE ACV55382.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1684810..1685304 GB:FROM 1684810 GB:TO 1685304 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55382.1 GB:DB_XREF GI:257475062 LENGTH 164 SQ:AASEQ MSKKKMRAFAGAMAVVLAFVPFLSGCAANDAEDNPQAQQELNADEQSRNEAEGSIGETVQYGQVMAMNGSTATVVVGTLANANDGSGSQAFNAGQDEITFDEGDVSIVDESGAELEGRTLSADDVIVMRGTGSGTDFKPTTIEILDVAGAGTNADDARVPQGVK GT:EXON 1|1-164:0| BL:SWS:NREP 1 BL:SWS:REP 11->151|FLGH_CUPTR|4e-04|27.0|141/229| TM:NTM 1 TM:REGION 7->29| HM:PFM:NREP 3 HM:PFM:REP 76->122|PF11766|7.7e-05|23.4|47/249|Candida_ALS_N| HM:PFM:REP 13->51|PF06474|0.00011|21.1|38/95|MLTD_N| HM:PFM:REP 47->89|PF11106|0.00084|41.9|43/80|YjbE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39,45-46,48-48,53-53,67-67,73-73,76-76,81-81,87-87,90-90,95-95,109-109,115-116,118-118,123-124,129-130,132-132,137-137| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHccHHHHHHHHHHcccccEEEEcEEEEEcccEEEEEEEEEEcccccccHHHccccccEEEEccccEEEEEcccccccccEEccccEEEEEEccccccccccEEEEEEEccccccccccccccccc //