[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55399.1
DDBJ      :             sec-independent translocation protein mttA/Hcf106
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->43 PF02416 * MttA_Hcf106 2.6e-14 52.6 38/53  
:BLT:SWISS 1->43 TATA_PROMS 4e-07 46.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55399.1 GT:GENE ACV55399.1 GT:PRODUCT sec-independent translocation protein mttA/Hcf106 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1704459..1704725 GB:FROM 1704459 GB:TO 1704725 GB:DIRECTION + GB:PRODUCT sec-independent translocation protein mttA/Hcf106 GB:NOTE PFAM: sec-independent translocation protein mttA/Hcf106; KEGG: thylakoid assembly protein, putative ; K03116 sec-independent protein translocase protein TatA GB:PROTEIN_ID ACV55399.1 GB:DB_XREF GI:257475079 InterPro:IPR003369 InterPro:IPR003998 LENGTH 88 SQ:AASEQ MKILGMGVPELLIILAVILLIFGPKNLPKLGASVGKTVKSLREGLGGGEKLVEADDEEEAVEEIVEEAAPAAAPKKTVKVAKKADKVA GT:EXON 1|1-88:0| BL:SWS:NREP 1 BL:SWS:REP 1->43|TATA_PROMS|4e-07|46.5|43/88| TM:NTM 1 TM:REGION 6->28| SEG 11->21|lliilavilli| SEG 49->87|eklveaddeeeaveeiveeaapaaapkktvkvakkadkv| HM:PFM:NREP 1 HM:PFM:REP 6->43|PF02416|2.6e-14|52.6|38/53|MttA_Hcf106| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------21----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 88-89| PSIPRED cccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHccccccc //