[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55401.1
DDBJ      :             transcriptional regulator, AraC family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  226/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.24.16a.4.1
:387 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   286->376 2k9sA PDBj 4e-09 33.0 %
:RPS:PDB   280->376 1bl0A PDBj 2e-20 21.6 %
:RPS:SCOP  284->376 1v4aA1  a.24.16.4 * 2e-18 14.0 %
:HMM:SCOP  276->327 1d5yA1 a.4.1.8 * 2.3e-08 32.7 %
:HMM:SCOP  330->378 1d5yA2 a.4.1.8 * 8.6e-14 57.1 %
:RPS:PFM   342->376 PF00165 * HTH_AraC 3e-05 48.6 %
:HMM:PFM   289->327 PF00165 * HTH_AraC 6.9e-07 30.8 39/42  
:HMM:PFM   342->377 PF00165 * HTH_AraC 5.5e-09 42.9 35/42  
:BLT:SWISS 280->375 RHAS_ENT38 4e-11 35.4 %
:PROS 331->373|PS00041|HTH_ARAC_FAMILY_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55401.1 GT:GENE ACV55401.1 GT:PRODUCT transcriptional regulator, AraC family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1706506..1707669) GB:FROM 1706506 GB:TO 1707669 GB:DIRECTION - GB:PRODUCT transcriptional regulator, AraC family GB:NOTE PFAM: helix-turn-helix- domain containing protein AraC type; SMART: helix-turn-helix- domain containing protein AraC type; KEGG: sme:SMa1749 putative transcriptional regulator GB:PROTEIN_ID ACV55401.1 GB:DB_XREF GI:257475081 InterPro:IPR000005 LENGTH 387 SQ:AASEQ MSDRDDSAEILDDDAEMRCAAAGSGSRALVESNLIGVGGDPAARSRAAYLAQRTSLADGLGSNGPFTVHDIYETQIASMHGVRVEAAERGRVGMLWEIDERYGQGTYWYYPLGDDLSVAIFDLQFNREVGFTCQTPDLFCFGSYGRNMVPYFGITDDPADRTLLGYAWKSQPYGQVTKADERLDVTSICMLPKGLQRLSLACHCDPLVLSRAIASLDGMQDVPGLNMVFDEMKRARPSSITAPAYYEAKVTEAAAMLLDWSLANARGAASAIRAADRSALNLTRAHIREHLDRAVPSSELCRIACMSASKLTRLFKQAEGMTPQEYARTLRMERACELLGDTDLSMAEIAARLGFARQGSFSEAFKERFGATPQEFRALRAARRSAR GT:EXON 1|1-387:0| BL:SWS:NREP 1 BL:SWS:REP 280->375|RHAS_ENT38|4e-11|35.4|96/278| PROS 331->373|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| SEG 261->279|slanargaasairaadrsa| SEG 377->386|ralraarrsa| BL:PDB:NREP 1 BL:PDB:REP 286->376|2k9sA|4e-09|33.0|91/107| RP:PDB:NREP 1 RP:PDB:REP 280->376|1bl0A|2e-20|21.6|97/116| RP:PFM:NREP 1 RP:PFM:REP 342->376|PF00165|3e-05|48.6|35/40|HTH_AraC| HM:PFM:NREP 2 HM:PFM:REP 289->327|PF00165|6.9e-07|30.8|39/42|HTH_AraC| HM:PFM:REP 342->377|PF00165|5.5e-09|42.9|35/42|HTH_AraC| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00165|IPR000005| GO:PFM GO:0005622|"GO:intracellular"|PF00165|IPR000005| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00165|IPR000005| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00165|IPR000005| RP:SCP:NREP 1 RP:SCP:REP 284->376|1v4aA1|2e-18|14.0|93/151|a.24.16.4| HM:SCP:REP 276->327|1d5yA1|2.3e-08|32.7|52/54|a.4.1.8|1/2|Homeodomain-like| HM:SCP:REP 330->378|1d5yA2|8.6e-14|57.1|49/0|a.4.1.8|2/2|Homeodomain-like| OP:NHOMO 452 OP:NHOMOORG 227 OP:PATTERN -------------------------------------------------------------------- --------------1----------1------1----------1-1--------1-----11--1--21-----------7-1-------73-2------211--9-111------------------------------------3121--------------1-1111------------------11-1------------1----2111-------1--1-------4J------------------1--------1-----------1------111------------------------11-----122---222-1-2-222211211211-22-1----1---13--22---1-------2---2-31---------131----11-1-----------2---1----21-1-3332231322343----113----211------------1--1-------------------------------11------14334352111122363333-3349-231--223-----1---1--1-----1-------------------1--1-1111--1----2------11-------------------------------1111--11----------------1--2------------------1--------------------------------1---12-----------------1--------------------------1---------541-----1---------22221---1-2-33234434165663111----------1213-----2-2321122222111------1---------------2-------------------------------------1-- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 25.1 SQ:SECSTR #######################################################################################################################################################################################################################################################################################HHHHHHHHHTTTTcccccHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccHHHH########### DISOP:02AL 20-20,386-388| PSIPRED ccccccHHHHHccccHHHHHcccccccHHHHcccccccccccccccHHHHHcccHHHHcccccccEEEEEEHHHHHHHHHccccccHHccccEEEEEccccccccEEEEEEcccccEEEEEccccccccEEEEcccccHHHcccHHHHcccccccccccccEEEcccccccccEEEEEcccEEEEEEEEEcccHHHHHHHHccccHHHHHHHHHcccHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcc //