[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55410.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:352 amino acids
:PSIPRED
:HMM:PFM   1->102 PF04245 * NA37 6.9e-06 23.5 102/335  
:BLT:SWISS 52->105 NDPA_ACTSZ 6e-04 31.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55410.1 GT:GENE ACV55410.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1719866..1720924 GB:FROM 1719866 GB:TO 1720924 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55410.1 GB:DB_XREF GI:257475090 LENGTH 352 SQ:AASEQ MKINHAILHVFDFVSCVNVYAQEELDLSSKNAKRYVTSHAKKALGNIDSKRGEFAENSMFAEELRCYFRGQREFVDLSVQVAEFIAGELGRMEKTESADLLVMDFEDDPDNTVREMTDDEAEAAYRGEGKRYFAFMLLEAKQAYMHEVGYGESGAQRVDIARHHAILPNPSQKVASFAVIESKTLSVSFCDKERAIAGENRWLIPDGLLQCSMEASSKEVFDAVTRIVEEVAEEYGANAAVAVSKAKAYVAENADESDELAPWDLGEEVFEDEPLQKRFEQALADEALPERVVVEKNVAKRVAKSHKIRTDTGIDITFPAEYGENPDFIEFVSGPNGLINIELKNIGHIENR GT:EXON 1|1-352:0| BL:SWS:NREP 1 BL:SWS:REP 52->105|NDPA_ACTSZ|6e-04|31.5|54/339| SEG 237->251|anaavavskakayva| HM:PFM:NREP 1 HM:PFM:REP 1->102|PF04245|6.9e-06|23.5|102/335|NA37| OP:NHOMO 42 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1--11----1111111111-----------111111111111111-1111111----------1--1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEEEEEEcccccEEEcccEEcccHHHHHHHHHHHHHHHcccHHHcEEEccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccccccccccccccccccEEEEEEEcccccEEccccccccccEEEEEEEEcccccccccccEEEEEEEcccccEEEEEEcccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHcccccEEEcHHHHHHHHHHHHHHcccccEEEEEHHHcccccEEEEEEccccEEEEEEEcHHHHccc //