[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55414.1
DDBJ      :             transcriptional regulator, XRE family
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->64 2qfcA PDBj 2e-04 32.8 %
:RPS:PDB   3->66 1d1lA PDBj 6e-15 10.0 %
:RPS:SCOP  3->66 1d1lA  a.35.1.2 * 4e-15 10.0 %
:HMM:SCOP  1->67 2bnmA1 a.35.1.3 * 1.8e-16 34.3 %
:RPS:PFM   7->45 PF01381 * HTH_3 6e-08 51.3 %
:HMM:PFM   9->60 PF01381 * HTH_3 6.9e-20 40.4 52/55  
:BLT:SWISS 11->51 Y272_METJA 2e-04 46.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55414.1 GT:GENE ACV55414.1 GT:PRODUCT transcriptional regulator, XRE family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1724651..1725094) GB:FROM 1724651 GB:TO 1725094 GB:DIRECTION - GB:PRODUCT transcriptional regulator, XRE family GB:NOTE PFAM: helix-turn-helix domain protein; SMART: helix-turn-helix domain protein; KEGG: bcr:BCAH187_A3663 helix-turn-helix domain protein GB:PROTEIN_ID ACV55414.1 GB:DB_XREF GI:257475094 InterPro:IPR001387 LENGTH 147 SQ:AASEQ MAIGDVLVRIRKERNLTQEDLARKLYVTRQAVSRWENGETTPGIDMCKLIAATCDVPVALLLEMPDGAYCQSCGMPFYQEKDHGTEADGSLSADYCSWCYANGAFLEDETLEELIERCAPFMAESCHITRDEAVSFMGALLPTLKRW GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 11->51|Y272_METJA|2e-04|46.3|41/66| BL:PDB:NREP 1 BL:PDB:REP 3->64|2qfcA|2e-04|32.8|61/284| RP:PDB:NREP 1 RP:PDB:REP 3->66|1d1lA|6e-15|10.0|60/61| RP:PFM:NREP 1 RP:PFM:REP 7->45|PF01381|6e-08|51.3|39/55|HTH_3| HM:PFM:NREP 1 HM:PFM:REP 9->60|PF01381|6.9e-20|40.4|52/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 3->66|1d1lA|4e-15|10.0|60/61|a.35.1.2| HM:SCP:REP 1->67|2bnmA1|1.8e-16|34.3|67/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 39 OP:NHOMOORG 36 OP:PATTERN --------------------------------2-------------11-------------------- ----------------------------------------------------------------------------11--12------111--1---------------------------------------------------------------------------------------------------------------------11-------11-----------------------------------------1--------11--111------1--------------------------------------1--11111111-1--211----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 100.0 SQ:SECSTR HHccEEEEHHHHHHHHcHHHHHHHHTccTHHHHHHHHTTccEEEEEcTTccEEEEEcHHHcccccccccHHHHHHHHHHHTTcGGGHHHHHHHHGGGTTccHHHHcEEEEEEEccccGGGccccccccccEEEEEEEccEEEEEccT DISOP:02AL 147-148| PSIPRED ccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHccccHHHHHHccccccHHccccccccccccHHHHHHHHccccEEEEccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcc //