[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55423.1
DDBJ      :             RNA polymerase, sigma-24 subunit, ECF subfamily
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  181/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->174 2q1zA PDBj 7e-12 30.0 %
:RPS:PDB   21->182 3dxjF PDBj 7e-14 11.1 %
:RPS:SCOP  21->118 1or7A2  a.177.1.1 * 1e-10 27.4 %
:RPS:SCOP  100->182 1iw7F2  a.4.13.2 * 1e-06 10.8 %
:HMM:SCOP  3->115 1or7A2 a.177.1.1 * 2.7e-17 30.4 %
:HMM:SCOP  117->184 1or7A1 a.4.13.2 * 1.2e-12 41.2 %
:RPS:PFM   33->95 PF04542 * Sigma70_r2 3e-04 38.7 %
:HMM:PFM   127->177 PF08281 * Sigma70_r4_2 2e-15 43.1 51/54  
:HMM:PFM   32->93 PF04542 * Sigma70_r2 6.3e-12 25.8 62/71  
:BLT:SWISS 21->182 SIGW_BACSU 2e-12 25.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55423.1 GT:GENE ACV55423.1 GT:PRODUCT RNA polymerase, sigma-24 subunit, ECF subfamily GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1735587..1736147 GB:FROM 1735587 GB:TO 1736147 GB:DIRECTION + GB:PRODUCT RNA polymerase, sigma-24 subunit, ECF subfamily GB:NOTE TIGRFAM: RNA polymerase sigma factor, sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2 domain protein; sigma-70 region 4 domain protein; KEGG: rde:RD1_3999 RNA polymerase ECF-type sigma factor, putative GB:PROTEIN_ID ACV55423.1 GB:DB_XREF GI:257475103 InterPro:IPR007627 InterPro:IPR007630 InterPro:IPR013249 InterPro:IPR014284 LENGTH 186 SQ:AASEQ MGEQDADDALARSALARIARGDEGALEELHSLYAPAVFAFVSARLGDRGAAEEAAVDVWLGCWRSAAAFRGDSRVLTWLLGIAKRQACMRMRRIRPEELPLDEDLTQLADEAGDPSDALIAQAGIGEIMAALDALPAALAETVRLAWLHELPYAEIAQVTDVPVGTVKSRVSRARALMQETLGGRL GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 21->182|SIGW_BACSU|2e-12|25.9|162/187| SEG 5->20|daddalarsalariar| SEG 130->140|aaldalpaala| BL:PDB:NREP 1 BL:PDB:REP 22->174|2q1zA|7e-12|30.0|150/176| RP:PDB:NREP 1 RP:PDB:REP 21->182|3dxjF|7e-14|11.1|162/349| RP:PFM:NREP 1 RP:PFM:REP 33->95|PF04542|3e-04|38.7|62/70|Sigma70_r2| HM:PFM:NREP 2 HM:PFM:REP 127->177|PF08281|2e-15|43.1|51/54|Sigma70_r4_2| HM:PFM:REP 32->93|PF04542|6.3e-12|25.8|62/71|Sigma70_r2| GO:PFM:NREP 5 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| RP:SCP:NREP 2 RP:SCP:REP 21->118|1or7A2|1e-10|27.4|95/113|a.177.1.1| RP:SCP:REP 100->182|1iw7F2|1e-06|10.8|83/100|a.4.13.2| HM:SCP:REP 3->115|1or7A2|2.7e-17|30.4|112/113|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 117->184|1or7A1|1.2e-12|41.2|68/68|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 249 OP:NHOMOORG 181 OP:PATTERN -------------------------------------------------------------------- 3-4--1-----1--1-------------------------2--2-1------1-1---------1-21221----1----1--------------------1--2-------------------------------22234---111------1------------1----------------111-----111----------------1--11----11-122------2------------------------------------------------------------------------------------------------------------11---------5---1--1--11----------2--1----------22222-11121----------1--1-------21--111--1-----11-112--1111221--------1-------------------------------------2-----111-1----121111111-111111121111---33--1-11-1211--21---1------------1-2------------------1---1-11-111-2-------------------------11---1-1-1-1-------1---------------11-2------------------------------------------------11------------------------------------------1---------111-1--------------------------1-----11------------------------1111111-1111333333231111------2211-----------------------------------------------3- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 87.1 SQ:SECSTR ####################HHHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTTccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHHHH#### DISOP:02AL 186-187| PSIPRED cccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccc //