[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55427.1
DDBJ      :             ABC transporter related
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:290 amino acids
:PSIPRED
:BLT:PDB   18->213 3dhwC PDBj 7e-24 34.4 %
:RPS:PDB   3->219 3b5jA PDBj 5e-41 26.2 %
:RPS:SCOP  3->224 1b0uA  c.37.1.12 * 6e-39 25.8 %
:HMM:SCOP  18->217 1ii8.1 c.37.1.12 * 1.1e-61 39.7 %
:RPS:PFM   42->165 PF00005 * ABC_tran 6e-18 41.5 %
:HMM:PFM   42->165 PF00005 * ABC_tran 1.7e-26 39.1 115/118  
:HMM:PFM   30->48 PF12128 * DUF3584 0.00062 47.4 19/1202  
:BLT:SWISS 20->59 UUP2_HAEIN 3e-05 45.0 %
:BLT:SWISS 31->215 YXLF_BACSU 5e-36 40.1 %
:PROS 137->151|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55427.1 GT:GENE ACV55427.1 GT:PRODUCT ABC transporter related GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1738468..1739340 GB:FROM 1738468 GB:TO 1739340 GB:DIRECTION + GB:PRODUCT ABC transporter related GB:NOTE PFAM: ABC transporter related; SMART: AAA ATPase; KEGG: rce:RC1_1686 ABC transporter, ATP-binding protein, putative GB:PROTEIN_ID ACV55427.1 GB:DB_XREF GI:257475107 InterPro:IPR003439 InterPro:IPR003593 InterPro:IPR017871 LENGTH 290 SQ:AASEQ MFISLDRLGKDFDKKPCALDDLTLDLPSGMIGLIGPNGAGKTTLMRILCGIVSPTRGHVLVDGRDIAEPRNRRALKKTLGYLPQDIEPYPNLTPPEFLDYVGILKGMDDKRERRRQADELIERVGLADVRRRRIGGFSGGMRRRVGIAQALMGDPRLLVVDEPTAGLDPEERMRFRTLIATLGADRTVILSTHILDDVAQTCPYVCVLRSGRLCYDGATAGLIDGAHGRTWLTPPLMAPPTGAVVVNAATTAEGTRYRIVSAAPPAGSQPVEPTLEDGYMALASDDRARA GT:EXON 1|1-290:0| BL:SWS:NREP 2 BL:SWS:REP 20->59|UUP2_HAEIN|3e-05|45.0|40/459| BL:SWS:REP 31->215|YXLF_BACSU|5e-36|40.1|177/295| PROS 137->151|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 238->252|apptgavvvnaatta| BL:PDB:NREP 1 BL:PDB:REP 18->213|3dhwC|7e-24|34.4|195/343| RP:PDB:NREP 1 RP:PDB:REP 3->219|3b5jA|5e-41|26.2|214/243| RP:PFM:NREP 1 RP:PFM:REP 42->165|PF00005|6e-18|41.5|118/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 42->165|PF00005|1.7e-26|39.1|115/118|ABC_tran| HM:PFM:REP 30->48|PF12128|0.00062|47.4|19/1202|DUF3584| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 3->224|1b0uA|6e-39|25.8|221/258|c.37.1.12| HM:SCP:REP 18->217|1ii8.1|1.1e-61|39.7|199/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 48955 OP:NHOMOORG 1173 OP:PATTERN aZKBVOHNZXXTXUbRjJPSPRRbxQVhpZhWHCEDFAHGGDCXcQalKQ*zi9SfRXaQSJJEZ178 UVwR*jgimmqbgXbVYPO-OiCCa*PPPPPOxusw****W*X*w*xkuldP**xRXhFF***m*y****gbddd*daaQ*hrC8C8CTTQM6OGJH--FGPJLIhMWTR57777778B99999HWSITaPJVSYTovv**NML*crhougfjbeUXNINJOGbfbj***XERHJIHIQEJIGkYfSQsl9Yiz*******************z****hsy**jryzzutw**ZjkjhjhgiijjjihYZWYZxcda**ZQZWbzyNO**YVSVkhjkinmqtslvswwnqnqmoqrmoqaabbZacbcbZZazmmhgipnqms*u*********k*jo***bhhf*skvp*guSI**neYeglSZhZmrRWXcNgWTTNKMLINhV***bTt****************-lt*ke*o***TC**************KML**********SRSSSSSSubfMRld*77577666755666BC7877778896577IDDFBE***********z*z*v********l********9L**u*evms*y****XlgMWJSlVIIKJJJKRRRamia**QdYvnUouablJgZbUSXjVabbVdu*b*HJKPGGFFIFD8AAAB9A9AHSEGKPOlnsQuTZJQJpSUVXUNTdSQQSXSaWUYY5-ENRNN211111****W*vv***w*x*uu-zvuwzvywwx**xqrusqu*****hghlmikjklkkkjikikk*njkqqqrS4************34HIEJEEGLMLMQH*l*ZZZZXZHPQMMQOTcNPQPPHTELQqexwxwz***t****i***CCCACBCCCKgmk*kllllw*yutRRQMLNMLMMGEEE76NSOOIHHI98778677*AW8866B-8AD8CC8CED9CF888557ZkpUVj*lokFbQ 2222ieK-gL8GWcTJIGEMPVUXNcPGFBCBDKLI9GEEFEDA9AIJHQQLXUONLCDFEFD6A75619729CA5A3AA7B99BF58-FH9I9DB8798B7IPJL5YkkkSXScUXJKFAISIlhDpH**f3gPkHJIBZIHXQDKGGGVGB*IUQMoKj*IoLkF*bl*TaZKDTNG*IJGHU*vp*G**MH*v**k ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEEEEEEcccEEEEEEEEEEEcccEEEEEccccccHHHHHHHHHccccccccEEEEccccccccccHHHHHHHccEEcccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHcccEEEEEEccEEEEEccHHHHHHHccccEEEEEEcccccccccEEEEcccccccEEEEEEccccccEEEEcccHHHHHHHHHccccccc //