[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55441.1
DDBJ      :             Aldose 1-epimerase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  173/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.30.5
:295 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   9->284 3dcdA PDBj 7e-27 32.5 %
:RPS:PDB   9->294 3dcdA PDBj 7e-43 26.7 %
:RPS:SCOP  9->294 1lurA  b.30.5.4 * 3e-29 20.2 %
:HMM:SCOP  3->297 1lurA_ b.30.5.4 * 2e-45 32.7 %
:RPS:PFM   5->284 PF01263 * Aldose_epim 3e-17 36.1 %
:HMM:PFM   8->289 PF01263 * Aldose_epim 3.1e-21 23.1 268/301  
:BLT:SWISS 6->293 LACXC_LACLA 1e-31 31.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55441.1 GT:GENE ACV55441.1 GT:PRODUCT Aldose 1-epimerase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1762021..1762908 GB:FROM 1762021 GB:TO 1762908 GB:DIRECTION + GB:PRODUCT Aldose 1-epimerase GB:NOTE PFAM: Aldose 1-epimerase; KEGG: bcr:BCAH187_A1765 putative LacX protein GB:PROTEIN_ID ACV55441.1 GB:DB_XREF GI:257475121 InterPro:IPR008183 LENGTH 295 SQ:AASEQ MRKLPTCVLENDALSVRVSPVGAELQSVVCGGVERMWSGDPAVWGRRAPLLFPLIGRLRDGWYANGGRRVDAPMHGFCRDRLFSAEQVSDVRVRFETASDERTRAVYPFDFRLTVDFTLEGSSIVKSHTVENQGDVPLPFELGGHEAYATRLLPGERMSDYFVRFEGVDVLEMFGMDEAGILTLPKVEVPLEDGRLTKTPEQLGIDTVVLENVPGSVATLASVAHGYEVTVEFSDFPYLGIWTKAGQDDARYLCIEPWSALPDARFSPRELSEKPGVRTLAPGERAVLEYRMTFR GT:EXON 1|1-295:0| BL:SWS:NREP 1 BL:SWS:REP 6->293|LACXC_LACLA|1e-31|31.3|284/299| BL:PDB:NREP 1 BL:PDB:REP 9->284|3dcdA|7e-27|32.5|255/292| RP:PDB:NREP 1 RP:PDB:REP 9->294|3dcdA|7e-43|26.7|277/292| RP:PFM:NREP 1 RP:PFM:REP 5->284|PF01263|3e-17|36.1|263/295|Aldose_epim| HM:PFM:NREP 1 HM:PFM:REP 8->289|PF01263|3.1e-21|23.1|268/301|Aldose_epim| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01263|IPR008183| GO:PFM GO:0016853|"GO:isomerase activity"|PF01263|IPR008183| RP:SCP:NREP 1 RP:SCP:REP 9->294|1lurA|3e-29|20.2|272/325|b.30.5.4| HM:SCP:REP 3->297|1lurA_|2e-45|32.7|284/0|b.30.5.4|1/1|Galactose mutarotase-like| OP:NHOMO 190 OP:NHOMOORG 173 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1-1---------11-1-------1-1-111-1-------------------------------------111111-----11--1-1-11111---1-----1-------------1111111111111111---1-111------1111111----------------------11212211212111122112111232112----111-------------------------12---2112---11-----------1--11111-----11------------------1------------12111--------------------11111111-1-----111-111---11---------------------111--------------------------------------1-----1111111----11111111111111111--111-------------------------------------------------------------11--1-------------------------------------------------------------------------------------------------------------------1----------------------------------------11111-----------------------------------------------------1-111111----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 286 STR:RPRED 96.9 SQ:SECSTR ########EEccEEEEEEETcTTEEEEEEETTccccccccTTTccccccEEcccccccGGGEEEETTEEEEccTTccGGGcccEEEEEETTEEEEEEEccHHHHHHccccEEEEEEEEEccTTEEEEEEEEEEcccccEEcEEEccEEEcccTTcccGGGEEEEEccccEEEcTTccEETTEETcGGGcEEEcTTccEEcccGGGTTEEEEcccccEEEEEETTcccEEEEEEETccEEEEEccccHccccEEEEEEEEcccccTTccccGGGcTTEEEEcTTcEEEEEEEEEE# PSIPRED ccEEEEEEEEcccEEEEEEccccEEEEEEEccEEEEEcccHHHccccccEEEEEEccccccEEEEccEEEEEEccccccccEEEEEEEcccEEEEEEEccHHHHccccEEEEEEEEEEEEccEEEEEEEEEEcccccEEEEEEccEEEEEccccccEEEEEEEEEcccEEEEEEEcccccccccccccccEEEcEEcccHHHccccEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccccccEEEEEcccccccccccccccccccccEEEccccEEEEEEEEEEc //