[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55445.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55445.1 GT:GENE ACV55445.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1766191..1766877 GB:FROM 1766191 GB:TO 1766877 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55445.1 GB:DB_XREF GI:257475125 LENGTH 228 SQ:AASEQ MKIMFKSPFSRWCDQMWLYLVYLLGVAMTCYLLWNWAAFDLPQKLACMLAVAVPLHVFEENTFPGGFFYMNNMGFGSKEPMVYPQNRCTNMITNLGAEIVIIAVALNAATIEPVVMSLVVFFALGETVNHTRSGILMYRKFKDRGKRTVYGPGLVTSWCVLVPMAAVALRWLVDCGATVWEVVGGIGIFLGIAVFLILVPFAFSIRIMSREYAFRDRGYFEKYVDGSR GT:EXON 1|1-228:0| TM:NTM 5 TM:REGION 13->35| TM:REGION 40->62| TM:REGION 98->120| TM:REGION 149->171| TM:REGION 181->203| SEG 63->76|fpggffymnnmgfg| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,25-25,81-81,95-95,101-101,104-104,109-109,171-172,174-174,179-179,185-185,188-188,221-221,227-229| PSIPRED ccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccHHEEEccccccccccccccccHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccEEEEEHHHccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //