[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55451.1
DDBJ      :             cobalt transport protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:225 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   102->185 3cd5D PDBj 7e-04 19.2 %
:RPS:PFM   79->179 PF02361 * CbiQ 6e-06 34.0 %
:HMM:PFM   5->182 PF02361 * CbiQ 7.8e-18 28.4 176/224  
:BLT:SWISS 102->221 Y195_MYCPN 2e-08 30.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55451.1 GT:GENE ACV55451.1 GT:PRODUCT cobalt transport protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1772497..1773174 GB:FROM 1772497 GB:TO 1773174 GB:DIRECTION + GB:PRODUCT cobalt transport protein GB:NOTE PFAM: cobalt transport protein; KEGG: hha:Hhal_0380 cobalt transport protein GB:PROTEIN_ID ACV55451.1 GB:DB_XREF GI:257475131 InterPro:IPR003339 LENGTH 225 SQ:AASEQ MLVVLIATGAIVKDYVLGSVLFAVVVLLSFAIGRGRMAASFSFAYLFLMGIFWVTTMLPPNAAGALGSFALACRTCMPICLFAAVFATTTKIGDLTAALYGMRLPKTVVVPLVIAVRFFPTLKEESSAVADAMRVRGLALSLKNLVSKPALMFESAVVPVMLRCAKIADELAAAAVARGIDRPGRKTSYNAPRFGRVDFLSLAFLVICCSLLVAVKVNQGIGGLL GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 102->221|Y195_MYCPN|2e-08|30.3|119/434| TM:NTM 5 TM:REGION 7->29| TM:REGION 37->59| TM:REGION 65->87| TM:REGION 102->124| TM:REGION 199->221| SEG 16->31|vlgsvlfavvvllsfa| RP:PDB:NREP 1 RP:PDB:REP 102->185|3cd5D|7e-04|19.2|78/416| RP:PFM:NREP 1 RP:PFM:REP 79->179|PF02361|6e-06|34.0|100/213|CbiQ| HM:PFM:NREP 1 HM:PFM:REP 5->182|PF02361|7.8e-18|28.4|176/224|CbiQ| GO:PFM:NREP 3 GO:PFM GO:0006824|"GO:cobalt ion transport"|PF02361|IPR003339| GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF02361|IPR003339| GO:PFM GO:0015087|"GO:cobalt ion transmembrane transporter activity"|PF02361|IPR003339| OP:NHOMO 72 OP:NHOMOORG 54 OP:PATTERN ----------------1---------------1-1----------1--------1-1----------- -----1-----11---1-------------------------------------------11---------1111-11--82--------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------1--1-1--1111--111111----1--------11---111-----1111--1-----111--------1-----221-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------9---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 34.7 SQ:SECSTR #####################################################################################################ccccEEEEEEEEccccEEEEEcccTTHHHHHHH#HHHHHHHTTccEEEEEEE#####EEEEccEEEcccHHHHHHHHHHHHcHH######################################## PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //