[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55463.1
DDBJ      :             iron (metal) dependent repressor, DtxR family
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  156/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.76.1
:138 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   21->124 2h09A PDBj 6e-16 39.4 %
:RPS:PDB   20->96 1biaA PDBj 8e-07 13.0 %
:RPS:SCOP  16->66 1on1A1  a.4.5.24 * 5e-11 39.2 %
:RPS:SCOP  76->134 1on1A2  a.76.1.1 * 8e-11 23.7 %
:HMM:SCOP  20->138 1ku9A_ a.4.5.36 * 1.1e-12 25.2 %
:RPS:PFM   17->67 PF01325 * Fe_dep_repress 6e-10 56.9 %
:RPS:PFM   76->131 PF02742 * Fe_dep_repr_C 5e-05 37.5 %
:HMM:PFM   76->134 PF02742 * Fe_dep_repr_C 1.9e-15 35.6 59/71  
:HMM:PFM   16->69 PF01325 * Fe_dep_repress 8.1e-14 33.3 54/60  
:BLT:SWISS 1->124 MNTR_ECOLI 1e-15 34.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55463.1 GT:GENE ACV55463.1 GT:PRODUCT iron (metal) dependent repressor, DtxR family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1787257..1787673 GB:FROM 1787257 GB:TO 1787673 GB:DIRECTION + GB:PRODUCT iron (metal) dependent repressor, DtxR family GB:NOTE PFAM: iron dependent repressor; regulatory protein MarR; SMART: iron dependent repressor; regulatory protein MarR; KEGG: mpo:Mpop_4272 iron (metal) dependent repressor, DtxR family GB:PROTEIN_ID ACV55463.1 GB:DB_XREF GI:257475143 InterPro:IPR000835 InterPro:IPR001367 LENGTH 138 SQ:AASEQ MRDEADASRGSRSRATTKSSEDYLEAILVIRRLRGSCRNVDIAERLGFSKASVTKALGNLARKGLVEVVDHDVRLTAAGKHLAEETLSKHRFFERLLANAGVNAEVASKEVCRMEHCISTDSFEKLSSHLGRIQDSLR GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 1->124|MNTR_ECOLI|1e-15|34.7|124/155| BL:PDB:NREP 1 BL:PDB:REP 21->124|2h09A|6e-16|39.4|104/127| RP:PDB:NREP 1 RP:PDB:REP 20->96|1biaA|8e-07|13.0|77/292| RP:PFM:NREP 2 RP:PFM:REP 17->67|PF01325|6e-10|56.9|51/59|Fe_dep_repress| RP:PFM:REP 76->131|PF02742|5e-05|37.5|56/68|Fe_dep_repr_C| HM:PFM:NREP 2 HM:PFM:REP 76->134|PF02742|1.9e-15|35.6|59/71|Fe_dep_repr_C| HM:PFM:REP 16->69|PF01325|8.1e-14|33.3|54/60|Fe_dep_repress| GO:PFM:NREP 6 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01325|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF01325|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01325|IPR001367| GO:PFM GO:0003700|"GO:transcription factor activity"|PF02742|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF02742|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02742|IPR001367| RP:SCP:NREP 2 RP:SCP:REP 16->66|1on1A1|5e-11|39.2|51/56|a.4.5.24| RP:SCP:REP 76->134|1on1A2|8e-11|23.7|59/74|a.76.1.1| HM:SCP:REP 20->138|1ku9A_|1.1e-12|25.2|111/151|a.4.5.36|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 209 OP:NHOMOORG 189 OP:PATTERN --1----111111111-------1-----1--------1111-12122-211-11111111------1 1------------------------------------------------11111111---1---12------------11411--------------------------------------------------------11--1-1-------------------------------------1--11--1--1-----------------------------1---------------------------------------------------------1--1---------------------------------------1-122221111-2---22----1-11--11-122-----------------1---------1------------------------1111111111--1-----1----------2-----------------11111--------------------------------------------------------------------------------------------------------------11--11------------------------2----------------------------------------------------------------------11---111111111111-1111111111111111111111-----1111111111111111111111111--------------1------------------------------------------------------------------------------------11111111111111---1--------------1---------------------------------1---1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 100.0 SQ:SECSTR HHHHHHHTTTHHHHHHHHTccHHHHHHHHHHTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETEEEcccccccccHHHHHHTcccccEHHHHHHHHHHHHHHHHHHTTTccHHHHHHHHHHcccccccTT PSIPRED ccHHHHHHHcccHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEccHHHEEcHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHcHHHHHcc //