[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55471.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->69 PF02417 * Chromate_transp 3.8e-05 20.6 63/169  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55471.1 GT:GENE ACV55471.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1793189..1793404 GB:FROM 1793189 GB:TO 1793404 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55471.1 GB:DB_XREF GI:257475151 LENGTH 71 SQ:AASEQ MLSNIIGLVSGCVTFLGGFLIVWGAVSLGLAIREQQGGAQIASAISTIAGGAIIIAAAIYFGQLDTSWLPA GT:EXON 1|1-71:0| TM:NTM 2 TM:REGION 7->29| TM:REGION 41->62| SEG 37->59|ggaqiasaistiaggaiiiaaai| HM:PFM:NREP 1 HM:PFM:REP 7->69|PF02417|3.8e-05|20.6|63/169|Chromate_transp| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------21----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccc //