[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55480.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:43 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->38 PF05004 * IFRD 0.00039 38.5 26/309  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55480.1 GT:GENE ACV55480.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1804116..1804247 GB:FROM 1804116 GB:TO 1804247 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55480.1 GB:DB_XREF GI:257475160 LENGTH 43 SQ:AASEQ MQSTICFFIGMAMMACAIVGYACIRVGAMSEREEMLAEGKREP GT:EXON 1|1-43:0| TM:NTM 1 TM:REGION 5->27| HM:PFM:NREP 1 HM:PFM:REP 13->38|PF05004|0.00039|38.5|26/309|IFRD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,25-25,31-31| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //