[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55493.1
DDBJ      :             protein of unknown function UPF0102
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:123 amino acids
:PSIPRED
:RPS:SCOP  9->99 2inbA1  c.52.1.32 * 4e-06 15.7 %
:RPS:PFM   15->66 PF02021 * UPF0102 8e-06 52.1 %
:HMM:PFM   13->102 PF02021 * UPF0102 5.9e-11 34.9 83/93  
:BLT:SWISS 7->122 Y930_CHLAD 6e-12 38.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55493.1 GT:GENE ACV55493.1 GT:PRODUCT protein of unknown function UPF0102 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1820220..1820591) GB:FROM 1820220 GB:TO 1820591 GB:DIRECTION - GB:PRODUCT protein of unknown function UPF0102 GB:NOTE PFAM: protein of unknown function UPF0102; KEGG: ppd:Ppro_1186 hypothetical protein GB:PROTEIN_ID ACV55493.1 GB:DB_XREF GI:257475173 InterPro:IPR003509 LENGTH 123 SQ:AASEQ MNTNPTLQDRAVEAAARFLEVRGYETLATGWKSPETRGTIDLVARDPESDDLVFVDVSARPNSGAGFGDGRNDRETMELLAVSWLVENDFAESVGVRFDKISMIVVGEDRALLRHHINAFGEA GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 7->122|Y930_CHLAD|6e-12|38.4|112/123| RP:PFM:NREP 1 RP:PFM:REP 15->66|PF02021|8e-06|52.1|48/93|UPF0102| HM:PFM:NREP 1 HM:PFM:REP 13->102|PF02021|5.9e-11|34.9|83/93|UPF0102| RP:SCP:NREP 1 RP:SCP:REP 9->99|2inbA1|4e-06|15.7|89/128|c.52.1.32| OP:NHOMO 8 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1132------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccEEEEEEEcccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEcccccHHHHHHHHHcccc //