[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55497.1
DDBJ      :             transcriptional regulator, XRE family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:139 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->62 1sq8A PDBj 7e-06 41.0 %
:RPS:PDB   1->62 2aw6A PDBj 2e-15 19.7 %
:RPS:SCOP  1->61 1y7yA1  a.35.1.3 * 2e-12 29.5 %
:HMM:SCOP  1->67 2bnmA1 a.35.1.3 * 2e-14 37.3 %
:RPS:PFM   7->61 PF01381 * HTH_3 3e-04 40.0 %
:HMM:PFM   7->59 PF01381 * HTH_3 2.1e-16 34.0 53/55  
:BLT:SWISS 1->62 RPC_BPPH1 1e-08 41.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55497.1 GT:GENE ACV55497.1 GT:PRODUCT transcriptional regulator, XRE family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1822768..1823187 GB:FROM 1822768 GB:TO 1823187 GB:DIRECTION + GB:PRODUCT transcriptional regulator, XRE family GB:NOTE PFAM: helix-turn-helix domain protein; SMART: helix-turn-helix domain protein; KEGG: hso:HS_0422 transcriptional regulator GB:PROTEIN_ID ACV55497.1 GB:DB_XREF GI:257475177 InterPro:IPR001387 LENGTH 139 SQ:AASEQ MTTGSRIRALRESRGMTQRQLAERAGCTDAAIRNYEAGRRALKGSALDAIAGALGVAPEALMPVQAESVRDALELLFRIEEEFGLRPVGGGRLAVAPGAEKAPKLAAAIKAWESQVDALDRGEITPEEYESWKMGIGGC GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 1->62|RPC_BPPH1|1e-08|41.9|62/144| BL:PDB:NREP 1 BL:PDB:REP 1->62|1sq8A|7e-06|41.0|61/64| RP:PDB:NREP 1 RP:PDB:REP 1->62|2aw6A|2e-15|19.7|61/287| RP:PFM:NREP 1 RP:PFM:REP 7->61|PF01381|3e-04|40.0|55/55|HTH_3| HM:PFM:NREP 1 HM:PFM:REP 7->59|PF01381|2.1e-16|34.0|53/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 1->61|1y7yA1|2e-12|29.5|61/69|a.35.1.3| HM:SCP:REP 1->67|2bnmA1|2e-14|37.3|67/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------21------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 85.6 SQ:SECSTR ccHHHHHHHHHHHTTccHHHHHTTHTccHHHHHHHHTTcccccHHHHHHHHHHHTccHHHHHHTTTccccHHHHHHHHHHHHHcccH##HHHHTTccHHHHHHHHHHHHHHHHHHHHHHHH################## PSIPRED ccHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccc //