[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55503.1
DDBJ      :             protein of unknown function DUF214
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:967 amino acids
:PSIPRED
:RPS:PFM   320->347 PF02687 * FtsX 4e-05 57.1 %
:RPS:PFM   806->888 PF02687 * FtsX 4e-05 31.7 %
:HMM:PFM   288->430 PF02687 * FtsX 7e-23 26.8 127/175  
:HMM:PFM   790->952 PF02687 * FtsX 5e-23 21.5 163/175  
:BLT:SWISS 748->875 Y1507_METJA 1e-05 27.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55503.1 GT:GENE ACV55503.1 GT:PRODUCT protein of unknown function DUF214 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1827978..1830881) GB:FROM 1827978 GB:TO 1830881 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF214 GB:NOTE PFAM: protein of unknown function DUF214; KEGG: gur:Gura_1658 hypothetical protein GB:PROTEIN_ID ACV55503.1 GB:DB_XREF GI:257475183 InterPro:IPR003838 LENGTH 967 SQ:AASEQ MAGIFTRFTLRSLAQNRVRTAVTVVGIALSTALLAAVLTSVASVQQGLLERTMVTEGSWHVFSPDVPAQGIDALVESDAVTDLATFRDLGSAALAPDDANRLGAFIALKTTPTTVKGVDEPGGAPYSLMPELASGRWPETADEIVLPDYLQGEELGAGGAEGVVSNGPLETGSTLTGGFGNLAAAEDGARLADGNETRVENARERTLTVTGFYKRQAPFLANNYTASSAPSVALTVADASEEGAAAGAYLVTQGLGTLDEMKAFFADATGLDDTAATLYHTSLFSYLGISDGRPIWGSLWAVAAVLAIVIVAASASLIYNAFAISVAERTRQFGLLASLGASKRQLRSTVLAEALLLGAVGVPIGLLAGVAGTAGAFSSSQEAFAAMLGSGSAGLAVHVDAGALAAAAALSIATLLVSAWVPSARAARVSAVDAIRQTQDVRLSKRAERSAPSHAPDVGRVKLGIAGRLFGIPGFVAHRNLSRSATRGRTVVASLAVSVTLVVVAGSTALYLAPLSDRASSSRGAGSGADIVVSAHPDYTTPREGNDLSDYAAEYDEFLARASEIEGLQLIGSCRQGQAESVVDGRMISQEARAARQAYNSQTSADWVPDSFGEDGDYYGALYTFFVDDASWRALLDELDLDVAAYTDPENPRAIGLNTYQDRMPDGTYVSTKPFAGTGAVDLYVTEEREGFSNMGLQEGPDGRPLVGYLDREAGVSGTADIVTAPIDEAATAFRIEIGALCDEEPAVLNAIAANNHFPSIILPESVAERAAGLGDYHSNPYTYSFAGASFTAEDHAKASDELEALARDLGDVVVNVSDIENAARQNRLIAQAFQLFVLCFSVITTLIAVANVFNTLANGIILRTREFAALRSIGMGNRAFARMLAYECASYALRGLGIGLAAAVAVTFALFAATSMAFAGLEFTLPWDYVALAVAIVAVVLALSVAYALRRSHASNIVEALRSDAI GT:EXON 1|1-967:0| BL:SWS:NREP 1 BL:SWS:REP 748->875|Y1507_METJA|1e-05|27.9|122/399| TM:NTM 7 TM:REGION 26->48| TM:REGION 301->323| TM:REGION 351->373| TM:REGION 392->414| TM:REGION 829->851| TM:REGION 899->921| TM:REGION 929->950| SEG 28->44|alstallaavltsvasv| SEG 152->162|geelgaggaeg| SEG 237->248|adaseegaaaga| SEG 263->278|affadatglddtaatl| SEG 298->318|slwavaavlaivivaasasli| SEG 350->362|vlaealllgavgv| SEG 365->376|gllagvagtaga| SEG 383->436|afaamlgsgsaglavhvdagalaaaaalsiatllvsawvpsaraarvsavdair| SEG 490->510|tvvaslavsvtlvvvagstal| SEG 516->530|sdrasssrgagsgad| SEG 634->645|alldeldldvaa| SEG 893->915|alrglgiglaaavavtfalfaat| SEG 931->950|valavaivavvlalsvayal| RP:PFM:NREP 2 RP:PFM:REP 320->347|PF02687|4e-05|57.1|28/177|FtsX| RP:PFM:REP 806->888|PF02687|4e-05|31.7|82/177|FtsX| HM:PFM:NREP 2 HM:PFM:REP 288->430|PF02687|7e-23|26.8|127/175|FtsX| HM:PFM:REP 790->952|PF02687|5e-23|21.5|163/175|FtsX| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF02687|IPR003838| GO:PFM GO:0016020|"GO:membrane"|PF02687|IPR003838| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------11---1----1--11-----111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHccccccEEEEEEccccEEEccccccccccEEEccccccccccccccccccccccccccccccccccccEEEHHHHHHcccccccccccccccccccccccccccccccHHccccccccccEEEEEccEEEEEEEEEEEEccccccccccHHHcccccEEEEEEcHHHHHHHHHHHccccccccccHHHHHcccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHcccccEEEEEEEEEEEEEEEcHHHHHHHHHHcccHHcccccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHccccEEcccHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEEEEccHHHHHHHHHccccHHHHcccccccEEEEcccccccccccccHHccccccccHHHHHHHHHHcccccHHHccccccccHHccccccccccccccccHHHHHcccccEEEEEEcccccccHHHHHccccccEEEEEcHHHHHHHccccccccccHHHHHcccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccc //