[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55507.1
DDBJ      :             transcriptional regulator, XRE family
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  188/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:71 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->63 3f52E PDBj 8e-04 34.4 %
:RPS:PDB   1->70 2ao9D PDBj 3e-09 17.1 %
:RPS:SCOP  14->70 2ofyA1  a.35.1.3 * 4e-10 24.6 %
:HMM:SCOP  1->65 2a6cA1 a.35.1.13 * 2.8e-10 29.2 %
:HMM:PFM   13->61 PF01381 * HTH_3 4.6e-08 29.2 48/55  
:BLT:SWISS 1->70 YOZG_BACSU 3e-20 58.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55507.1 GT:GENE ACV55507.1 GT:PRODUCT transcriptional regulator, XRE family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1833429..1833644) GB:FROM 1833429 GB:TO 1833644 GB:DIRECTION - GB:PRODUCT transcriptional regulator, XRE family GB:NOTE SMART: helix-turn-helix domain protein; KEGG: glo:Glov_0100 transcriptional regulator, XRE family GB:PROTEIN_ID ACV55507.1 GB:DB_XREF GI:257475187 InterPro:IPR001387 LENGTH 71 SQ:AASEQ MAIVLRLDRMMADRKVSLGELAEKVGIADGNLSKLKNGKVSGVRFKTLNAICKELDCQPGDILEFVDDEEG GT:EXON 1|1-71:0| BL:SWS:NREP 1 BL:SWS:REP 1->70|YOZG_BACSU|3e-20|58.6|70/100| BL:PDB:NREP 1 BL:PDB:REP 2->63|3f52E|8e-04|34.4|61/78| RP:PDB:NREP 1 RP:PDB:REP 1->70|2ao9D|3e-09|17.1|70/107| HM:PFM:NREP 1 HM:PFM:REP 13->61|PF01381|4.6e-08|29.2|48/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 14->70|2ofyA1|4e-10|24.6|57/82|a.35.1.3| HM:SCP:REP 1->65|2a6cA1|2.8e-10|29.2|65/0|a.35.1.13|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 228 OP:NHOMOORG 189 OP:PATTERN ---------------------------------------------1---------------------- -1--2--1111---------------------------------11----1--21---------1-111------111--31------1111-------1-1-1-2---------------------------------------------------------------1-------------1--------1-1111121121212211-11-111211121-1111111-1---------------------11------1-11----1-----------1---1--------------------------211--1111--2111212222212111341---1--1---1--221---------1-------2221-------------1-111-------------1----------------------1121211-----1------------------------------------------------11-----------111---------111-111--1-------------1----------------------------1-------11-------1----------------------------------------11----1------1--21-1------1-12---------------11----------------------------------1--111-----------------1------------------------1-1---1112--------------------------------221211-----------11111111111111-------1--11-----------------------------------------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 70 STR:RPRED 98.6 SQ:SECSTR HHHHHHHHHHcccccccHHHHHHHHTccHHHHHHHHHHcHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHH# PSIPRED ccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHEEEEccccc //