[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55516.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   56->70 PF03047 * ComC 0.00056 40.0 15/32  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55516.1 GT:GENE ACV55516.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1839806..1840099 GB:FROM 1839806 GB:TO 1840099 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55516.1 GB:DB_XREF GI:257475196 LENGTH 97 SQ:AASEQ METIEELFRKVLDDEDLRASFGQALEGDRLEVFLRENGCEAAPSEVREALEGMFREELGDELLDEVNGGMAKYRLYLHEPFLKTTSAASQKIKIIKG GT:EXON 1|1-97:0| HM:PFM:NREP 1 HM:PFM:REP 56->70|PF03047|0.00056|40.0|15/32|ComC| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,31-31,87-88,90-90| PSIPRED ccHHHHHHHHHccHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcHHHHHHHHHHHHEEEccc //