[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55543.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  134/915 : Eukaryota  58/199 : Viruses  0/175   --->[See Alignment]
a.1.2d.58.1
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->89 1fcaA PDBj 1e-07 40.8 %
:RPS:PDB   38->94 1dwlA PDBj 3e-08 22.8 %
:RPS:SCOP  36->96 1hfeL2  d.58.1.5 * 3e-10 27.9 %
:HMM:SCOP  1->94 1nekB1 a.1.2.1 * 3.8e-18 31.5 %
:HMM:PFM   40->60 PF00037 * Fer4 3.4e-07 47.6 21/24  
:HMM:PFM   70->92 PF00037 * Fer4 3.6e-09 39.1 23/24  
:BLT:SWISS 9->110 NDHI_SYNPW 2e-15 35.3 %
:PROS 45->56|PS00198|4FE4S_FER_1
:PROS 76->87|PS00198|4FE4S_FER_1
:REPEAT 2|44->74|75->109

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55543.1 GT:GENE ACV55543.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1872323..1872679 GB:FROM 1872323 GB:TO 1872679 GB:DIRECTION + GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: dds:Ddes_1668 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:PROTEIN_ID ACV55543.1 GB:DB_XREF GI:257475223 InterPro:IPR001450 InterPro:IPR017900 LENGTH 118 SQ:AASEQ MGSFKLGKMTLGGLFKKPETLMYPVETKTPPAGLKGHVVNDVDRCILCGICQKRCPCAAIVVDKPARTWTIDRFRCVQCGSCVRECPKDCLTMEPTYTPPATSKHVDSFEVPETKKTA GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 9->110|NDHI_SYNPW|2e-15|35.3|102/218| PROS 45->56|PS00198|4FE4S_FER_1|PDOC00176| PROS 76->87|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|44->74|75->109| BL:PDB:NREP 1 BL:PDB:REP 37->89|1fcaA|1e-07|40.8|49/55| RP:PDB:NREP 1 RP:PDB:REP 38->94|1dwlA|3e-08|22.8|57/59| HM:PFM:NREP 2 HM:PFM:REP 40->60|PF00037|3.4e-07|47.6|21/24|Fer4| HM:PFM:REP 70->92|PF00037|3.6e-09|39.1|23/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 36->96|1hfeL2|3e-10|27.9|61/85|d.58.1.5| HM:SCP:REP 1->94|1nekB1|3.8e-18|31.5|92/0|a.1.2.1|1/1|alpha-helical ferredoxin| OP:NHOMO 241 OP:NHOMOORG 213 OP:PATTERN -----1-------------1111------1-------2-----11111---11-1111111------- ---------------------1---1-----------1--1-11-----------------------------------1111-1-1------------------11----------------------------------1111-11111111111111111111111-1111111111111111-----------------------------------------------------------------------------------------------------------------------------------------2--------------1-------1-1--1--1---1-----1--122----1---------------------------------------------------------1------1-----------------111-11-----11111----1-11111111--1111111-------------------------------------------------------------------------------1---111111-1111113-2--1-1-------------------------1---------------------------------------1---------11------------------------------------11--------------------------------------------1111111111----------------------------------------------------------1--------------11---------------------------------------------------------------------3- ------1-----11--------------------------------------------------------------------------------1-1-11---1-2-----15232-111-11-11111151--12--1-31112-11--1--111111----1-1111--111--11-----1--1-2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 83.9 SQ:SECSTR ########HHHHHHHHHHHHHTTcTTcHHHHHHHHHEEEEcccccccccGGGGTcTTTEEEEEcccEEEccTTcccGGGGTGGGGcTTccEEEcTGcccccTTccHc########### DISOP:02AL 118-119| PSIPRED ccEEcHHHHHHHHHccccccccccccccccccccccEEEEccccccccccHHHHcccccEEEEccccEEEEEHHHccccccHHHHcccccEEEEEcccccccccEEEEEEcccHHccc //