[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55547.1
DDBJ      :             amino acid-binding ACT domain protein
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  63/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.18
:142 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->141 2f06A PDBj 5e-20 32.6 %
:RPS:PDB   2->115 2dt9A PDBj 4e-08 22.8 %
:RPS:SCOP  1->68 2f06A2  d.58.18.11 * 2e-18 33.8 %
:HMM:SCOP  1->69 2f06A2 d.58.18.11 * 8e-11 30.4 %
:HMM:SCOP  70->141 2f06A1 d.58.18.11 * 3.6e-10 29.6 %
:HMM:PFM   4->60 PF01842 * ACT 3.2e-08 33.3 57/66  
:HMM:PFM   71->122 PF01842 * ACT 1.7e-06 19.2 52/66  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55547.1 GT:GENE ACV55547.1 GT:PRODUCT amino acid-binding ACT domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1877319..1877747 GB:FROM 1877319 GB:TO 1877747 GB:DIRECTION + GB:PRODUCT amino acid-binding ACT domain protein GB:NOTE PFAM: amino acid-binding ACT domain protein; KEGG: dal:Dalk_1710 amino acid-binding ACT domain protein GB:PROTEIN_ID ACV55547.1 GB:DB_XREF GI:257475227 InterPro:IPR002912 LENGTH 142 SQ:AASEQ MISQLTVFLENEKGRLAAACRAVSDAGINMHALNLADTSDFGVVRMLTDTPEAAAEALREQGYRATVTPVLAVRVPNVPGGLAKLLEFMDEQDANVEYGYCFSVNEDYAVDVLKADGSDDLEQKLTDAGFEPVRPEDIYRID GT:EXON 1|1-142:0| BL:PDB:NREP 1 BL:PDB:REP 4->141|2f06A|5e-20|32.6|135/141| RP:PDB:NREP 1 RP:PDB:REP 2->115|2dt9A|4e-08|22.8|114/153| HM:PFM:NREP 2 HM:PFM:REP 4->60|PF01842|3.2e-08|33.3|57/66|ACT| HM:PFM:REP 71->122|PF01842|1.7e-06|19.2|52/66|ACT| RP:SCP:NREP 1 RP:SCP:REP 1->68|2f06A2|2e-18|33.8|68/70|d.58.18.11| HM:SCP:REP 1->69|2f06A2|8e-11|30.4|69/0|d.58.18.11|1/2|ACT-like| HM:SCP:REP 70->141|2f06A1|3.6e-10|29.6|71/0|d.58.18.11|2/2|ACT-like| OP:NHOMO 98 OP:NHOMOORG 82 OP:PATTERN -----------------------1--------222---111111111111111--------------- --------------------------------------------------------------------------------22------1112-2--------------------------------1-11--11-------111----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1-------2-1-----11--1111--11---1----2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2121111111111-2221111211111--11---------------------11---------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 99.3 SQ:SECSTR EEEEEEEEEEccTTHHHHHHHHHHHHTccEEcccccccTTEEEEEEEEEGGGHHHHHHHHHccEEEEEcEEEccGGGcTHHHHHHHHHHHHTTccccEEEEEEEEGGGHHHHHHHEccHHHHHHHHHTTcEEEcHHHHTTc# PSIPRED ccEEEEEEEEccccHHHHHHHHHHHccccEEEEEccccccEEEEEEEEccHHHHHHHHHHcccEEEcccEEEEEEcccccHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEccHHHHHHHHHHcccEEEcHHHHcccc //