[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55552.1
DDBJ      :             amino acid-binding ACT domain protein
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  65/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.18
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->135 2f06A PDBj 4e-15 32.1 %
:RPS:PDB   5->122 2dt9A PDBj 2e-06 18.6 %
:RPS:SCOP  3->70 2f06A2  d.58.18.11 * 3e-17 33.8 %
:RPS:SCOP  71->142 2hmfA3  d.58.18.10 * 2e-04 21.3 %
:HMM:SCOP  1->70 2f06A2 d.58.18.11 * 1.8e-12 27.1 %
:HMM:SCOP  71->138 2f06A1 d.58.18.11 * 4.2e-07 30.9 %
:HMM:PFM   6->53 PF01842 * ACT 1.1e-07 33.3 48/66  
:HMM:PFM   75->110 PF01842 * ACT 1.9e-07 36.1 36/66  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55552.1 GT:GENE ACV55552.1 GT:PRODUCT amino acid-binding ACT domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1882132..1882566 GB:FROM 1882132 GB:TO 1882566 GB:DIRECTION + GB:PRODUCT amino acid-binding ACT domain protein GB:NOTE PFAM: amino acid-binding ACT domain protein; KEGG: dol:Dole_2322 amino acid-binding ACT domain- containing protein GB:PROTEIN_ID ACV55552.1 GB:DB_XREF GI:257475232 InterPro:IPR002912 LENGTH 144 SQ:AASEQ MSVQQISVFLESRPGHLRRVLDAFEDAHVSVRGYSASDTGDYGIVRFIVDAPDKALAVLQDMGAAATQTDVLCARLDDVPGELARVMGIMADCGINVTYSYSLISTYIALSVKDIARAEKLLAAQPVELIGQDDLARPVAPESR GT:EXON 1|1-144:0| BL:PDB:NREP 1 BL:PDB:REP 4->135|2f06A|4e-15|32.1|131/141| RP:PDB:NREP 1 RP:PDB:REP 5->122|2dt9A|2e-06|18.6|118/153| HM:PFM:NREP 2 HM:PFM:REP 6->53|PF01842|1.1e-07|33.3|48/66|ACT| HM:PFM:REP 75->110|PF01842|1.9e-07|36.1|36/66|ACT| RP:SCP:NREP 2 RP:SCP:REP 3->70|2f06A2|3e-17|33.8|68/70|d.58.18.11| RP:SCP:REP 71->142|2hmfA3|2e-04|21.3|71/95|d.58.18.10| HM:SCP:REP 1->70|2f06A2|1.8e-12|27.1|70/0|d.58.18.11|1/2|ACT-like| HM:SCP:REP 71->138|2f06A1|4.2e-07|30.9|68/0|d.58.18.11|2/2|ACT-like| OP:NHOMO 105 OP:NHOMOORG 84 OP:PATTERN -----------------------1--------222---111111111111111--------------- --------------------------------------------------------------------------------22------1112-2--------------------------------1-11--11-------111----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1-------2-1-----11--1111--11---1----21----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2121111111111-2221111212222--11---------------------11---------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 92.4 SQ:SECSTR ##EEEEEEEEEccTTHHHHHHHHHHHHTcccEcccccccTTEEEEEEEEEGGGHHHHHHHHHccEEEEEcEEEccGGGcTHHHHHHHHHHHHTTcccEEEEcccEEEEEEEGGGHHHHHHHHHHTTcEEEcHHHH######### DISOP:02AL 144-145| PSIPRED cccEEEEEEEEccccHHHHHHHHHHHccccEEEEEEcccccEEEEEEEEccHHHHHHHHHHcccEEEEccEEEEEEcccccHHHHHHHHHHHccccEEEEEEccccEEEEEEccHHHHHHHHHHcccEEEcHHHHHcccccccc //