[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55561.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   60->141 PF03151 * TPT 1.2e-05 19.5 82/153  
:HMM:PFM   42->72 PF03840 * SecG 0.00029 22.6 31/74  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55561.1 GT:GENE ACV55561.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1892497..1892934) GB:FROM 1892497 GB:TO 1892934 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55561.1 GB:DB_XREF GI:257475241 LENGTH 145 SQ:AASEQ MEIARLVLGVLLLVAFALLTVQLYNGRWLFLIAKPEKTKKGTFFPEGTANTGKRAAWVMVACFAVTATLMAYEMSKMTGVPAFAQTSSILNNIALVAFCLSLLWTLFAGRDEQNYRDRFKKDGARLLVLLLGACAVMTALSILFV GT:EXON 1|1-145:0| TM:NTM 4 TM:REGION 5->26| TM:REGION 55->75| TM:REGION 86->108| TM:REGION 123->145| SEG 4->23|arlvlgvlllvafalltvql| HM:PFM:NREP 2 HM:PFM:REP 60->141|PF03151|1.2e-05|19.5|82/153|TPT| HM:PFM:REP 42->72|PF03840|0.00029|22.6|31/74|SecG| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 45-46,48-48,53-54,59-59,62-62,67-67,73-73,81-81,95-95,101-102,104-104,109-109| PSIPRED cHHHHHHHHHHHHHHHHHHHHHEEccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHc //