[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55564.1
DDBJ      :             thioesterase superfamily protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  178/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->134 1z54B PDBj 2e-16 35.9 %
:RPS:PDB   5->139 3ck1A PDBj 3e-16 17.8 %
:RPS:SCOP  5->138 2oiwA1  d.38.1.1 * 1e-23 19.2 %
:HMM:SCOP  1->138 2hx5A1 d.38.1.1 * 8.4e-38 39.4 %
:HMM:PFM   17->100 PF03061 * 4HBT 5.8e-19 31.2 77/79  
:BLT:SWISS 7->137 YNEP_BACSU 1e-24 40.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55564.1 GT:GENE ACV55564.1 GT:PRODUCT thioesterase superfamily protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1895700..1896149 GB:FROM 1895700 GB:TO 1896149 GB:DIRECTION + GB:PRODUCT thioesterase superfamily protein GB:NOTE PFAM: thioesterase superfamily protein; KEGG: bcy:Bcer98_2255 thioesterase superfamily protein GB:PROTEIN_ID ACV55564.1 GB:DB_XREF GI:257475244 InterPro:IPR006683 InterPro:IPR006684 LENGTH 149 SQ:AASEQ MRVCTPITIRYAETDMMGIVYHANYLLYFEDARTRFLEAIGFPYDHIEQAGYLSPVTHFECDYGAPLRYGDTAVVRTRVVSSRPTKTVYAYEVFREGQDLDIEKPCCTGRSTHCLVDAETFKPVSLKRAVPELYERYLEVLEPEEGESR GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 7->137|YNEP_BACSU|1e-24|40.5|126/138| SEG 74->88|vvrtrvvssrptktv| BL:PDB:NREP 1 BL:PDB:REP 1->134|1z54B|2e-16|35.9|128/131| RP:PDB:NREP 1 RP:PDB:REP 5->139|3ck1A|3e-16|17.8|129/138| HM:PFM:NREP 1 HM:PFM:REP 17->100|PF03061|5.8e-19|31.2|77/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 5->138|2oiwA1|1e-23|19.2|125/131|d.38.1.1| HM:SCP:REP 1->138|2hx5A1|8.4e-38|39.4|132/0|d.38.1.1|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 187 OP:NHOMOORG 179 OP:PATTERN -------------------------------1------------------------------------ 111----------------------1-------111--------------------------------------------1--1-11----1-------1222211211-------------------------1------------------------------------------------11111---11111111111111111111111111111111111111111111111111111111111111-------1--------------------------11----------------------------------11-111111111-1-2-11-11-1-1--111--1111---1--1111---1-1-----------------------------------------------------------------1----111---------------------------------------------------------------1111--11111111--1-----------------------11-1-------------------11111-11111------12-11111-11------------------------------------------------------------1--1------------------------------------------------------------------------------------------------------1----111---------------------------------111-------------------1-1------------------------1-----------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 93.3 SQ:SECSTR ccEEEEEEccGGGccTTccccHHHHHHHHHHHHHHHHHTccccHHHHTTTcEEccEEEEEEEEcccccTTcEEEEEEEEEEEcccEEEEEEEEcTTcccccTccEEEEEEEEEEcEEETTEEEccccHHHHHHHTTccT########## DISOP:02AL 148-150| PSIPRED cEEEEEEEEcHHHHcccccEEHHHHHHHHHHHHHHHHHHccccHHHHHHcccEEEEEEEEEEEEEccccccEEEEEEEEEEEcccEEEEEEEEEEccccccccEEEEEEEEEEEEEEcccccEEcccHHHHHHHHHHHHHHcccccccc //