[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55565.1
DDBJ      :             protein tyrosine phosphatase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  429/915 : Eukaryota  101/199 : Viruses  0/175   --->[See Alignment]
c.44.1
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->151 2gi4A PDBj 5e-26 37.2 %
:RPS:PDB   4->151 1c0eA PDBj 5e-32 29.3 %
:RPS:SCOP  6->151 1c0eA  c.44.1.1 * 4e-35 29.7 %
:HMM:SCOP  1->151 1d1qA_ c.44.1.1 * 4.4e-39 38.7 %
:RPS:PFM   5->149 PF01451 * LMWPc 2e-21 42.8 %
:HMM:PFM   6->149 PF01451 * LMWPc 2.1e-28 32.4 136/140  
:BLT:SWISS 7->149 YFKJ_BACSU 5e-25 37.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55565.1 GT:GENE ACV55565.1 GT:PRODUCT protein tyrosine phosphatase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1896146..1896622 GB:FROM 1896146 GB:TO 1896622 GB:DIRECTION + GB:PRODUCT protein tyrosine phosphatase GB:NOTE PFAM: Protein-tyrosine phosphatase, low molecular weight; SMART: Protein-tyrosine phosphatase, low molecular weight; KEGG: bca:BCE_0521 low molecular weight phosphotyrosine protein phosphatase family protein GB:PROTEIN_ID ACV55565.1 GB:DB_XREF GI:257475245 InterPro:IPR000106 InterPro:IPR017867 LENGTH 158 SQ:AASEQ MSAPHRILFVCHGNICRSTMAEFVMKDLVSRRGMANAFVIGSAATHDDEIGSPVHHGTRAVLEAQGIDCSGKTARRLRRADADEWDLFVGMDEANMRDMRRQLGRAAEGRCFKLLEFADSARDVADPWYTGDFNVTYDDVLAGCAGLLAWLDSGAPRS GT:EXON 1|1-158:0| BL:SWS:NREP 1 BL:SWS:REP 7->149|YFKJ_BACSU|5e-25|37.1|143/156| BL:PDB:NREP 1 BL:PDB:REP 6->151|2gi4A|5e-26|37.2|145/156| RP:PDB:NREP 1 RP:PDB:REP 4->151|1c0eA|5e-32|29.3|147/154| RP:PFM:NREP 1 RP:PFM:REP 5->149|PF01451|2e-21|42.8|138/141|LMWPc| HM:PFM:NREP 1 HM:PFM:REP 6->149|PF01451|2.1e-28|32.4|136/140|LMWPc| GO:PFM:NREP 2 GO:PFM GO:0004725|"GO:protein tyrosine phosphatase activity"|PF01451|IPR017867| GO:PFM GO:0006470|"GO:protein amino acid dephosphorylation"|PF01451|IPR017867| RP:SCP:NREP 1 RP:SCP:REP 6->151|1c0eA|4e-35|29.7|145/154|c.44.1.1| HM:SCP:REP 1->151|1d1qA_|4.4e-39|38.7|150/0|c.44.1.1|1/1|Phosphotyrosine protein phosphatases I| OP:NHOMO 571 OP:NHOMOORG 530 OP:PATTERN -------------------------------------------------------------------- ----1-11111-1-11111-11--1-1111111-------1---112-111-1--1-1----11-1111-111111111-111-----1111-111-----11111--11---------------111-11---1111111---1-11111111111111111111111111111111111111--11---111111111111111111-1111111111111--11111111-11111111111111111111111--1-111--11--------11111111111111111111111111111111111111111111111-----------------------1-----11------1---1-------1----11------1--------------11--11111-11--11--11--111-11111-----1-11---1---11---------11--111------------------------------11111111113111111111111111111111111-11-----111--1--2----21----11111111111111------------------------11-1---------111111----------1--------1111-11-11111111111-1---------1211--------------------------------------------------------------------------------------------1----------1-11---11-------111-------111111111111111111----1111111111---111111-----111111111111111---111111-----------------------------1------------------1 ----1------1--111---111--1--------111111111---1-11111111111111----11-1-1---11-1-------11----1---------1111----112-1221-1--1121121232-2221-1---152-1---1114-121122--111-5224-1-1-1------1-2112-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 99.4 SQ:SECSTR ccccEEEEEEEcccccHHHHHHHHHHHHHHHTTcGGGEEEEEEEcccTTTTccccHHHHHHHHHTTccccccccccccTTHHHHccEEEEccHHHHHHHHHHTTccTTcEEEEGGGGcTTcccccccTTccHHHHHHHHHHHHHHHHHTTcHTTHHc# DISOP:02AL 158-159| PSIPRED cccccEEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEEcccccccccccccHHHHHHHHHccccccccccccccHHHHHHccEEEEccHHHHHHHHHHcccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccc //