[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55574.1
DDBJ      :             transcriptional regulator, MerR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  147/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:135 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->121 3gp4B PDBj 9e-16 35.9 %
:RPS:PDB   17->116 3d70A PDBj 2e-16 22.0 %
:RPS:SCOP  17->118 1jbgA  a.6.1.3 * 1e-14 18.6 %
:HMM:SCOP  17->124 1q06A_ a.6.1.3 * 9.2e-23 35.2 %
:HMM:PFM   19->55 PF00376 * MerR 1.4e-10 40.5 37/38  
:HMM:PFM   60->123 PF09278 * MerR-DNA-bind 4.1e-08 26.6 64/65  
:BLT:SWISS 19->121 ADHR_BACSU 2e-15 35.0 %
:PROS 20->42|PS00552|HTH_MERR_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55574.1 GT:GENE ACV55574.1 GT:PRODUCT transcriptional regulator, MerR family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1905057..1905464) GB:FROM 1905057 GB:TO 1905464 GB:DIRECTION - GB:PRODUCT transcriptional regulator, MerR family GB:NOTE PFAM: regulatory protein MerR; SMART: regulatory protein MerR; KEGG: bsu:BSU27000 hypothetical protein GB:PROTEIN_ID ACV55574.1 GB:DB_XREF GI:257475254 InterPro:IPR000551 LENGTH 135 SQ:AASEQ MDASEHGAQADNTLPCFGISEVADMAGISAFTIRYYDKCGFFPQLARDARGVRTFSQSDVAQLYFVDALRKSGLSIEGIQYYVKLQRRGAATRDERLAIVRAQETVLEYQRAELDESLKRLSAAGVELSTDRKSR GT:EXON 1|1-135:0| BL:SWS:NREP 1 BL:SWS:REP 19->121|ADHR_BACSU|2e-15|35.0|103/140| PROS 20->42|PS00552|HTH_MERR_1|PDOC00477| BL:PDB:NREP 1 BL:PDB:REP 19->121|3gp4B|9e-16|35.9|103/130| RP:PDB:NREP 1 RP:PDB:REP 17->116|3d70A|2e-16|22.0|100/276| HM:PFM:NREP 2 HM:PFM:REP 19->55|PF00376|1.4e-10|40.5|37/38|MerR| HM:PFM:REP 60->123|PF09278|4.1e-08|26.6|64/65|MerR-DNA-bind| RP:SCP:NREP 1 RP:SCP:REP 17->118|1jbgA|1e-14|18.6|102/106|a.6.1.3| HM:SCP:REP 17->124|1q06A_|9.2e-23|35.2|108/127|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 214 OP:NHOMOORG 148 OP:PATTERN -------------------------------------------------------------------- ----1-------1-1-----------------111111------11------------------1--2-1----------33--------------------------------------------------------------1-------------------------------------------1----1-----2-----122-1-11121-1----1--45555313----------------------3-22-1-1-23--33322--13431-1-----1111111111111--------------11---1111---35----------1111----1-----1---112-----1--1-------------------1-1------1---------------------------------------1---1-------1-------------1------------------------------------------111111-1111111111111111------------------------------1111111-------------------1-----------------------1-11---1--------------------1------1------1---1-----------1-------1--------------------------------------------------------------------------------------------------------1-1111--------------1--------------1-----------------------1--------------------2-----------------------------------1------------------1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------5---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 85.2 SQ:SECSTR ################EEHHHHHHHHTccHHHHHHHHHTTccccEEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc#### DISOP:02AL 134-136| PSIPRED ccccccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcc //