[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55578.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55578.1 GT:GENE ACV55578.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1908425..1908691) GB:FROM 1908425 GB:TO 1908691 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55578.1 GB:DB_XREF GI:257475258 LENGTH 88 SQ:AASEQ MKNFEMNCPVEGTSALQPKLDSAPARRARIIAFPQHAVLPDRDGASIVSAVRTGSAQGVAFGRVQRWQAVVGGCVFAALALASLFAGF GT:EXON 1|1-88:0| TM:NTM 1 TM:REGION 67->88| SEG 25->32|arrariia| SEG 76->87|faalalaslfag| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 34-34,39-39,45-45,48-48,53-54,59-60,62-62,67-67,81-81,87-89| PSIPRED cccccccccccccccccccccccccccEEEEEccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //