[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55601.1
DDBJ      :             Exonuclease RNase T and DNA polymerase III
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  166/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
c.15.1c.55.3
:367 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->164 2p1jB PDBj 5e-08 31.2 %
:BLT:PDB   287->326 2k6gA PDBj 5e-04 37.5 %
:RPS:PDB   3->232 3cg7A PDBj 5e-21 11.7 %
:RPS:PDB   220->361 1dgtB PDBj 1e-10 25.2 %
:RPS:SCOP  3->163 1j53A  c.55.3.5 * 2e-26 23.1 %
:RPS:SCOP  282->361 1cdzA  c.15.1.1 * 1e-08 15.1 %
:HMM:SCOP  3->165 1fxxA_ c.55.3.5 * 3.7e-36 32.1 %
:HMM:SCOP  275->367 1l7bA_ c.15.1.2 * 6.8e-08 27.7 %
:RPS:PFM   7->153 PF00929 * Exonuc_X-T 4e-11 33.3 %
:HMM:PFM   4->158 PF00929 * Exonuc_X-T 3.6e-19 28.8 153/165  
:HMM:PFM   281->349 PF00533 * BRCT 2.3e-09 26.2 61/78  
:HMM:PFM   195->220 PF08161 * NUC173 6.1e-05 42.3 26/198  
:BLT:SWISS 3->151 DPO3_CLOTE 1e-11 36.1 %
:BLT:SWISS 230->351 DNLJ_UNCTG 5e-08 31.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55601.1 GT:GENE ACV55601.1 GT:PRODUCT Exonuclease RNase T and DNA polymerase III GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1935868..1936971 GB:FROM 1935868 GB:TO 1936971 GB:DIRECTION + GB:PRODUCT Exonuclease RNase T and DNA polymerase III GB:NOTE PFAM: Exonuclease RNase T and DNA polymerase III; SMART: Exonuclease; KEGG: mex:Mext_0325 exonuclease RNase T and DNA polymerase III GB:PROTEIN_ID ACV55601.1 GB:DB_XREF GI:257475281 InterPro:IPR001357 InterPro:IPR006055 InterPro:IPR013520 LENGTH 367 SQ:AASEQ MLYTFFDVETPNRRNDRICSIGAVVTDQDGTVVEKKSYLVNPESSFDDINVRIHGIAPVDVRNAKTFPELWYDSLSAFFPVDGVVAHNARFDLSVLTKTLVSYDIPSPKMSYACTLDMSKKIDFIGGGKLPHVCEALGIELERHHQAESDATACMRVFWTLVGMAGCMPSFIAYEPGAKSCKKSGGRYRSISDKTKAMQWLIPLLREVVSNGKVSTFEAEAVLEFFGLHEELTSDPALSPIVALLQNAIADGWVDEAESNELANLISHIVNPSSSIEDSVDFANRKFVLTGSFNHGTKDDVSAFIQERGGEVLQNVTKTCDYVVIGGCGSEAYSLGSYGGKVKKALDWQAKGVPMQVIEECDLYGER GT:EXON 1|1-367:0| BL:SWS:NREP 2 BL:SWS:REP 3->151|DPO3_CLOTE|1e-11|36.1|144/1427| BL:SWS:REP 230->351|DNLJ_UNCTG|5e-08|31.8|110/674| BL:PDB:NREP 2 BL:PDB:REP 16->164|2p1jB|5e-08|31.2|144/171| BL:PDB:REP 287->326|2k6gA|5e-04|37.5|40/109| RP:PDB:NREP 2 RP:PDB:REP 3->232|3cg7A|5e-21|11.7|230/296| RP:PDB:REP 220->361|1dgtB|1e-10|25.2|127/660| RP:PFM:NREP 1 RP:PFM:REP 7->153|PF00929|4e-11|33.3|147/163|Exonuc_X-T| HM:PFM:NREP 3 HM:PFM:REP 4->158|PF00929|3.6e-19|28.8|153/165|Exonuc_X-T| HM:PFM:REP 281->349|PF00533|2.3e-09|26.2|61/78|BRCT| HM:PFM:REP 195->220|PF08161|6.1e-05|42.3|26/198|NUC173| RP:SCP:NREP 2 RP:SCP:REP 3->163|1j53A|2e-26|23.1|160/174|c.55.3.5| RP:SCP:REP 282->361|1cdzA|1e-08|15.1|73/96|c.15.1.1| HM:SCP:REP 3->165|1fxxA_|3.7e-36|32.1|159/0|c.55.3.5|1/1|Ribonuclease H-like| HM:SCP:REP 275->367|1l7bA_|6.8e-08|27.7|83/92|c.15.1.2|1/1|BRCT domain| OP:NHOMO 185 OP:NHOMOORG 168 OP:PATTERN ---------------------------------1---------------------------------- -----111111-1-------------------------1-----1----111112111----11----111---------1-------1111-111---1--1---11--1111111---------------------------1-1--1-------------------------------------------1------1-----1---1------1----111--------1121211122111221111111111111111111111111111----11-----------------------------------------1111-22222221212----111111----1---------1--11-1-----1111---------------1---------------11111111-----111111111----1---1--1-------------------1-------------------------------------11----------------------------------------------------------------------1---1-1-1---------------------------------------------1-------1--------------------------------------1------------------------------------------------------------------------------------------------1-------------------------------1-----------------------1--------------------------------------------------------------------------1---11---1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------- STR:NPRED 360 STR:RPRED 98.1 SQ:SECSTR #EEEEEEEEEcTTccccEEEEEEEEEETTTEEEEEEEEEccccccccHHHHHHHcccHHHHHTcccHHHHHHHHHHHHcccTTEEEEcccHHHHTHHHHHHHHTTccccGGGcEEEEHHcccccccccHHHHHHHHTTcccccTTcHHHHHHHHHHHHHHHHHTTccccccEEEEcccGGGcccccccTTGGGHHHcccEEEEccGGGcGGGTTccTTTcccTTTTcccGGGcccccccHHHH###HHHHHHHHcHHHHHHHHHHHTTTcccccccccccTTcccccccccccccccTTHHHHcccccccccccccccccccccEccccTTTH###HHcccccccTTTccccccccccTTTHHHTcc DISOP:02AL 367-368| PSIPRED ccEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEEEEEcccccccHHHHHHHcccHHHHcccccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHcccccccccEEcHHHHHHHHcccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHccEEEEcccccEEEEEEcccccccccccccccHHHHHHHHccccccEEEEcHHHHHccc //