[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55606.1
DDBJ      :             DNA repair protein RecO
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  194/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4g.45.1
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->161 1u5kA PDBj 9e-07 30.7 %
:RPS:SCOP  5->80 1u5kA1  b.40.4.13 * 2e-13 28.8 %
:RPS:SCOP  84->250 1u5kA2  g.45.1.2 * 2e-07 17.2 %
:HMM:SCOP  2->81 1u5kA1 b.40.4.13 * 4.5e-15 45.5 %
:HMM:SCOP  83->243 1u5kA2 g.45.1.2 * 1.6e-24 30.9 %
:RPS:PFM   6->78 PF11967 * RecO_N 2e-10 38.4 %
:RPS:PFM   87->246 PF02565 * RecO_C 2e-05 30.2 %
:HMM:PFM   5->80 PF11967 * RecO_N 3.5e-19 39.5 76/80  
:HMM:PFM   85->247 PF02565 * RecO_C 2e-17 32.5 117/118  
:BLT:SWISS 12->247 RECO_ALKMQ 2e-26 32.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55606.1 GT:GENE ACV55606.1 GT:PRODUCT DNA repair protein RecO GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1938933..1939703) GB:FROM 1938933 GB:TO 1939703 GB:DIRECTION - GB:PRODUCT DNA repair protein RecO GB:NOTE TIGRFAM: DNA repair protein RecO; PFAM: Recombination protein O RecO; KEGG: dal:Dalk_0046 DNA repair protein RecO GB:PROTEIN_ID ACV55606.1 GB:DB_XREF GI:257475286 InterPro:IPR003717 LENGTH 256 SQ:AASEQ MSQPTYDARAIVLRKTKLGESDLILALLAEDGSQIRAVAKGARKPASSFAARLELYSVVDLLVARGRSLDIVKEARLVESNERLRRDIEHAAGAAPIAELLDRVTQMGLENPRLFALTRTALSSLGRVDPAQVPAVCAAHLLKTLAFAGLRPSLDVCVSCGRDVEAVPESGLMALSYQEGGAVCAACRSSVETVLVPASTVAWCRALLSSTFAEIEILEADPSAAFSVLRFCQQWVSEHVGANLKSLNFLFTCGLF GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 12->247|RECO_ALKMQ|2e-26|32.6|230/246| BL:PDB:NREP 1 BL:PDB:REP 5->161|1u5kA|9e-07|30.7|150/242| RP:PFM:NREP 2 RP:PFM:REP 6->78|PF11967|2e-10|38.4|73/78|RecO_N| RP:PFM:REP 87->246|PF02565|2e-05|30.2|149/156|RecO_C| HM:PFM:NREP 2 HM:PFM:REP 5->80|PF11967|3.5e-19|39.5|76/80|RecO_N| HM:PFM:REP 85->247|PF02565|2e-17|32.5|117/118|RecO_C| GO:PFM:NREP 2 GO:PFM GO:0006281|"GO:DNA repair"|PF02565|IPR003717| GO:PFM GO:0006310|"GO:DNA recombination"|PF02565|IPR003717| RP:SCP:NREP 2 RP:SCP:REP 5->80|1u5kA1|2e-13|28.8|73/78|b.40.4.13| RP:SCP:REP 84->250|1u5kA2|2e-07|17.2|151/157|g.45.1.2| HM:SCP:REP 2->81|1u5kA1|4.5e-15|45.5|77/0|b.40.4.13|1/1|Nucleic acid-binding proteins| HM:SCP:REP 83->243|1u5kA2|1.6e-24|30.9|152/0|g.45.1.2|1/1|ArfGap/RecO-like zinc finger| OP:NHOMO 194 OP:NHOMOORG 194 OP:PATTERN -------------------------------------------------------------------- ----111-1111-111111-11111111111111111111111-11111111111111111111111---1111111111111-------------------------1------------------11111-1--111111111111111111111------1--111111---1---1--1--------111111111111111111111111111111111111111111---------------111---1---------------------------------------------------------------------11------------1111----1-1--11-1111111111111111-----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----------111-11-------11-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 150 STR:RPRED 58.6 SQ:SECSTR ####EEEEEEEEEEEEEcTTccEEEEEEETTE#EEEEEETTcTT##cTTTTTccTTcEEEEEEEcccccEEEEEE#EEEEccGGGGcHHHHHHHHHHHHHHHHHccTTcccHHHHHHHHHHHHHHHcccHHHHHHHHH###HHHHTTccccccccccTTTc############################################################################################### DISOP:02AL 256-257| PSIPRED ccccccEEEEEEEEEEcccccEEEEEEEcccccEEEEEEccccccccccHHHcccccEEEEEEEccccccEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEcccEEEcHHHccccccccccHHHHHHHHHHHcccHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcc //