[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55619.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:HMM:PFM   10->63 PF04401 * DUF540 4.4e-06 26.4 53/188  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55619.1 GT:GENE ACV55619.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1952609..1952803) GB:FROM 1952609 GB:TO 1952803 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55619.1 GB:DB_XREF GI:257475299 LENGTH 64 SQ:AASEQ MARKDDFDWLDDPFDEKKAAKDEMRAATSGGTKLALGCGCLIAVVGIVVLLGFVLVNMAEIMAS GT:EXON 1|1-64:0| TM:NTM 1 TM:REGION 38->60| SEG 5->15|ddfdwlddpfd| SEG 37->56|gcgcliavvgivvllgfvlv| HM:PFM:NREP 1 HM:PFM:REP 10->63|PF04401|4.4e-06|26.4|53/188|DUF540| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccccccHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //