[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55623.1
DDBJ      :             DNA polymerase III, delta subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  89/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.80.1c.37.1
:328 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  13->135 1jqlB  c.37.1.20 * 2e-13 19.2 %
:RPS:SCOP  211->314 1jqjC1  a.80.1.1 * 4e-08 20.6 %
:HMM:SCOP  1->208 1jr3D2 c.37.1.20 * 1.8e-16 16.7 %
:HMM:SCOP  209->324 1jr3D1 a.80.1.1 * 2e-09 22.4 %
:RPS:PFM   19->186 PF06144 * DNA_pol3_delta 7e-16 31.9 %
:HMM:PFM   18->186 PF06144 * DNA_pol3_delta 2.7e-24 25.7 167/172  
:BLT:SWISS 16->310 YQEN_BACSU 1e-14 25.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55623.1 GT:GENE ACV55623.1 GT:PRODUCT DNA polymerase III, delta subunit GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1956248..1957234) GB:FROM 1956248 GB:TO 1957234 GB:DIRECTION - GB:PRODUCT DNA polymerase III, delta subunit GB:NOTE TIGRFAM: DNA polymerase III, delta subunit; PFAM: DNA polymerase III delta; KEGG: sfu:Sfum_2086 DNA polymerase III, delta subunit GB:PROTEIN_ID ACV55623.1 GB:DB_XREF GI:257475303 InterPro:IPR005790 InterPro:IPR010372 LENGTH 328 SQ:AASEQ MNGMATQKKQEAPLLPVYLIVGEDALKRDTVMKRLRARLSSMGDLSFNADEFDGETAQGGDIVTACNTVPFASPVRLVEVRAADKLKKADAEQLVSYLGSPNGSTVLALVAEKLAKNTRLYKAVAACGKTAVIDCAPLKRYELPRTVRSMAVTHGVTLTEGAAVKLVDLVGEDTVHLDSELKKIALAHRGTDAVNEHEIVDMVSRTAEVKPWEFVDAFAARDVRKCLLYLGRMDSVSPHALLAMCTTRLRELVCARSMADRGNPRGVAAALKAPDWRVKNHVNWARGFTAAELRRAIISSRDTERAMKSGADPRSAFLDWVLAVTARR GT:EXON 1|1-328:0| BL:SWS:NREP 1 BL:SWS:REP 16->310|YQEN_BACSU|1e-14|25.9|293/347| RP:PFM:NREP 1 RP:PFM:REP 19->186|PF06144|7e-16|31.9|166/168|DNA_pol3_delta| HM:PFM:NREP 1 HM:PFM:REP 18->186|PF06144|2.7e-24|25.7|167/172|DNA_pol3_delta| GO:PFM:NREP 4 GO:PFM GO:0003677|"GO:DNA binding"|PF06144|IPR010372| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF06144|IPR010372| GO:PFM GO:0006260|"GO:DNA replication"|PF06144|IPR010372| GO:PFM GO:0009360|"GO:DNA polymerase III complex"|PF06144|IPR010372| RP:SCP:NREP 2 RP:SCP:REP 13->135|1jqlB|2e-13|19.2|120/140|c.37.1.20| RP:SCP:REP 211->314|1jqjC1|4e-08|20.6|102/117|a.80.1.1| HM:SCP:REP 1->208|1jr3D2|1.8e-16|16.7|204/211|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 209->324|1jr3D1|2e-09|22.4|116/127|a.80.1.1|1/1|DNA polymerase III clamp loader subunits, C-terminal domain| OP:NHOMO 91 OP:NHOMOORG 89 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------1----------------1111------1111-1111---1---11-1-1------------------------1-1--11---1---------------------1-----------------------1---1111111111111211---1111111111-11111111---------------------1------1-----11---11-------------------------------------------------------------------------1----111-1----1-1111---------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------111111111-----1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 328-329| PSIPRED ccHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcc //