[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55627.1
DDBJ      :             DNA-directed RNA polymerase, omega subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.143.1
:86 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  5->84 1iw7E  a.143.1.1 * 1e-05 20.5 %
:HMM:SCOP  3->82 1i6vE_ a.143.1.1 * 2.3e-09 29.1 %
:HMM:PFM   55->75 PF01192 * RNA_pol_Rpb6 0.00097 33.3 21/57  
:BLT:SWISS 3->78 RPOZ_CLAMS 2e-06 34.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55627.1 GT:GENE ACV55627.1 GT:PRODUCT DNA-directed RNA polymerase, omega subunit GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1962271..1962531) GB:FROM 1962271 GB:TO 1962531 GB:DIRECTION - GB:PRODUCT DNA-directed RNA polymerase, omega subunit GB:NOTE TIGRFAM: DNA-directed RNA polymerase, omega subunit GB:PROTEIN_ID ACV55627.1 GB:DB_XREF GI:257475307 InterPro:IPR003716 LENGTH 86 SQ:AASEQ MSIIEPKIDVLLNETDNDRFLLCALASKRAHDINDMMRGQRDRAIQLQTAVEIARAADKKPLSLAFNEIARGEVSYDPNSIDVNYH GT:EXON 1|1-86:0| BL:SWS:NREP 1 BL:SWS:REP 3->78|RPOZ_CLAMS|2e-06|34.7|75/89| HM:PFM:NREP 1 HM:PFM:REP 55->75|PF01192|0.00097|33.3|21/57|RNA_pol_Rpb6| RP:SCP:NREP 1 RP:SCP:REP 5->84|1iw7E|1e-05|20.5|78/95|a.143.1.1| HM:SCP:REP 3->82|1i6vE_|2.3e-09|29.1|79/0|a.143.1.1|1/1|RPB6/omega subunit-like| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,31-32,34-34,39-39,86-87| PSIPRED cccccccEEEEEEcccccEEEEEEEcccccccHHHHHccccccEEEEHHHHHHHHHcccccHHEEHHHHHccEEccccccEEEccc //