[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55632.1
DDBJ      :             oxidoreductase FAD/NAD(P)-binding domain protein
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  211/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1
:269 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->262 1ep1B PDBj 5e-24 34.0 %
:RPS:PDB   7->235 2b5oA PDBj 4e-12 11.4 %
:RPS:SCOP  7->105 1ep1B1  b.43.4.2 * 7e-09 30.8 %
:RPS:SCOP  126->268 1ep1B2  c.25.1.3 * 1e-16 32.6 %
:HMM:SCOP  2->106 1ep3B1 b.43.4.2 * 3.3e-15 31.3 %
:HMM:SCOP  101->269 1ep3B2 c.25.1.3 * 4.1e-35 36.3 %
:RPS:PFM   35->103 PF00970 * FAD_binding_6 3e-04 33.3 %
:RPS:PFM   138->217 PF00175 * NAD_binding_1 2e-05 38.2 %
:RPS:PFM   231->268 PF10418 * DHODB_Fe-S_bind 1e-10 68.4 %
:HMM:PFM   231->267 PF10418 * DHODB_Fe-S_bind 3.6e-18 64.9 37/40  
:HMM:PFM   117->216 PF00175 * NAD_binding_1 7e-14 33.3 99/109  
:HMM:PFM   8->88 PF00970 * FAD_binding_6 8.5e-07 21.2 80/99  
:BLT:SWISS 6->268 PYRK_GEOSW 5e-27 36.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55632.1 GT:GENE ACV55632.1 GT:PRODUCT oxidoreductase FAD/NAD(P)-binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1965411..1966220) GB:FROM 1965411 GB:TO 1966220 GB:DIRECTION - GB:PRODUCT oxidoreductase FAD/NAD(P)-binding domain protein GB:NOTE PFAM: oxidoreductase FAD/NAD(P)-binding domain protein; KEGG: dal:Dalk_1941 oxidoreductase FAD/NAD(P)- binding domain protein GB:PROTEIN_ID ACV55632.1 GB:DB_XREF GI:257475312 InterPro:IPR001221 InterPro:IPR001433 LENGTH 269 SQ:AASEQ MALVNERARILANEEVGPNLYLMELAASHIAASIEPGQFVHMKVPSMEAHILRRPFSVYARDAAAGTLEVLYQSVGFGTDHMTRIEPERAEHLSGAELIGPVGRGWQPPANARRALLVGGGVGAAPLFMLCESLISAGVRTDVVLGAQTEAALTCRGRYEALLDEPPRCATDDGSFGREGFCTSLVAEALAEAAEAGEPYDYLAVCGPEPLMKIVAGMAAEAGVPCEVSMEKRMACGVGACLSCVVDTVGGKQRACVDGPVFDARKVVW GT:EXON 1|1-269:0| BL:SWS:NREP 1 BL:SWS:REP 6->268|PYRK_GEOSW|5e-27|36.7|245/257| SEG 112->125|arrallvgggvgaa| SEG 187->198|aealaeaaeage| BL:PDB:NREP 1 BL:PDB:REP 4->262|1ep1B|5e-24|34.0|247/261| RP:PDB:NREP 1 RP:PDB:REP 7->235|2b5oA|4e-12|11.4|229/292| RP:PFM:NREP 3 RP:PFM:REP 35->103|PF00970|3e-04|33.3|63/99|FAD_binding_6| RP:PFM:REP 138->217|PF00175|2e-05|38.2|76/107|NAD_binding_1| RP:PFM:REP 231->268|PF10418|1e-10|68.4|38/38|DHODB_Fe-S_bind| HM:PFM:NREP 3 HM:PFM:REP 231->267|PF10418|3.6e-18|64.9|37/40|DHODB_Fe-S_bind| HM:PFM:REP 117->216|PF00175|7e-14|33.3|99/109|NAD_binding_1| HM:PFM:REP 8->88|PF00970|8.5e-07|21.2|80/99|FAD_binding_6| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00970|IPR008333| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00970|IPR008333| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00175|IPR001433| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00175|IPR001433| RP:SCP:NREP 2 RP:SCP:REP 7->105|1ep1B1|7e-09|30.8|91/101|b.43.4.2| RP:SCP:REP 126->268|1ep1B2|1e-16|32.6|135/160|c.25.1.3| HM:SCP:REP 2->106|1ep3B1|3.3e-15|31.3|99/0|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 101->269|1ep3B2|4.1e-35|36.3|157/0|c.25.1.3|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| OP:NHOMO 359 OP:NHOMOORG 244 OP:PATTERN ----------------1------1--------111111111111222211222112-122--112-1- -1--------------------------------------1----------------------1------111111112121-1111122222222-----------------------------22222122322-----222--------------------------------------------112-111111111111111111111111111111111111111--1--------------1----2----------------1-----111-------11111111111111-------------11-111----2111433333334342222222223221121221122212112332121--11-----------------11--1--------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------2122213121--112121122321111--22------------------------------------------------------------1--1------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------1112--------------11-------------------1------112-121212--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 96.3 SQ:SECSTR ###ccTEEEEcccTTccccEEEEEEEcTTccccccTTcEEEEEccTTTEEcccEEEEcTTTTTcccEEEEEEEccEEEcTTTccEEETccTTcccEEEEEEEccTTccccTTcEEEEEEEGGGGHHHHHHHHHHHTcccccccEEEEccGGGcTTHHHHHHHHHHcTTTTTcccTTcccccHHHHHHHTHHHHHHHHTcTTEEEEEEcGGGHHHHHHHHHHHHHHTTccHHHHHHcccccccTTEEEcccTTccETTTccEE####### DISOP:02AL 269-270| PSIPRED ccccccEEEEEEEEEccccEEEEEEEccccccccccccEEEEEEccccccEEEEEEEEccccccccEEEEEEEEcccHHHHHHHHcccccEEEEEEEEEccccccccccccccEEEEEEccccHHHHHHHHHHHHHcccEEEEEEEEccHHHHHcHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHccccEEEEEccccccccccccEEEEEccccEEEEcccccEEEHHHccc //