[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55641.1
DDBJ      :             Uracil phosphoribosyltransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  447/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.61.1
:195 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   8->180 2igbA PDBj 1e-47 56.2 %
:RPS:PDB   8->180 1a4xA PDBj 2e-13 53.6 %
:RPS:SCOP  8->180 1a3cA  c.61.1.1 * 2e-31 53.7 %
:HMM:SCOP  7->172 1w30A_ c.61.1.1 * 1e-42 37.3 %
:HMM:PFM   10->137 PF00156 * Pribosyltran 2.3e-18 28.6 119/125  
:BLT:SWISS 8->182 PYRR_PELTS 9e-50 57.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55641.1 GT:GENE ACV55641.1 GT:PRODUCT Uracil phosphoribosyltransferase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1977562..1978149) GB:FROM 1977562 GB:TO 1978149 GB:DIRECTION - GB:PRODUCT Uracil phosphoribosyltransferase GB:NOTE PFAM: phosphoribosyltransferase; KEGG: bcy:Bcer98_2540 pyrimidine regulatory protein PyrR GB:PROTEIN_ID ACV55641.1 GB:DB_XREF GI:257475321 InterPro:IPR000836 LENGTH 195 SQ:AASEQ MNDAGTVKTVCMDADEIERSLTRIAHQILETNKGAGNIALVGIVTRGDLLAKRLAEKIEAIEGTKVPLGKLDISFYRDDFATHLSPEVHSTDILFDLDGKDVVLVDDVLYTGRTIRAALDALMDIGRPSTVQLAVLVDRGHRQLPIRADFVGKNVPSSSDENVRLFLEEADGKSEVEILEIAPGSRAGSAPLGGE GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 8->182|PYRR_PELTS|9e-50|57.1|175/181| SEG 94->109|lfdldgkdvvlvddvl| BL:PDB:NREP 1 BL:PDB:REP 8->180|2igbA|1e-47|56.2|169/172| RP:PDB:NREP 1 RP:PDB:REP 8->180|1a4xA|2e-13|53.6|166/167| HM:PFM:NREP 1 HM:PFM:REP 10->137|PF00156|2.3e-18|28.6|119/125|Pribosyltran| RP:SCP:NREP 1 RP:SCP:REP 8->180|1a3cA|2e-31|53.7|164/166|c.61.1.1| HM:SCP:REP 7->172|1w30A_|1e-42|37.3|166/0|c.61.1.1|1/1|PRTase-like| OP:NHOMO 469 OP:NHOMOORG 447 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11--1111111111111111111111111111111111--11111111111-------11111-----------------1211122121--------------------------111111111-1111111111111111111111111111-11111-1111111111111111111111111111111111111111111111111111111111111111111111111212112122222111111111-1111111111111111111111111111111111111111111111111111222222212111111111-11--1--111111111111111111-11----------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111111111111-1111211111---------111111--11111111111111111111111111-111-------------------------11----1----------------------------1111------------------------------------------------------------------------------------------------------111-111111111111-111----------1-11111111111111111----------------------------------------11-----------------------------------1------1--11-1----11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 93.3 SQ:SECSTR ##TTTTccEEEEcHHHHHHHHHHHHHHHHHHTGGGTTEEEEEEcHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccEEEEEcccccTTcEEEEEEEEEEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEEEEcccccccccccEEEEEccccTTcEEEEEcTTTccccEEEEEcTccc########### PSIPRED ccccccEEEEEEcHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHcccccEEEEEEEEEEcccccccccEEEccccccccccccEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEEEEccccccccccccEEEEEcccccccEEEEEEcccccccEEEEEcccccccccccccccc //