[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55649.1
DDBJ      :             molybdopterin oxidoreductase Fe4S4 region
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  363/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.81.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->199 1h0hA PDBj 7e-36 47.0 %
:RPS:PDB   50->198 2e7zA PDBj 9e-24 21.3 %
:RPS:SCOP  39->199 2fug32  c.81.1.1 * 8e-31 27.1 %
:HMM:SCOP  35->199 1h0hA2 c.81.1.1 * 1.6e-45 39.0 %
:RPS:PFM   50->94 PF04879 * Molybdop_Fe4S4 1e-12 48.9 %
:HMM:PFM   46->94 PF04879 * Molybdop_Fe4S4 7.6e-20 51.0 49/55  
:HMM:PFM   2->21 PF10518 * TAT_signal 4.3e-06 45.0 20/26  
:HMM:PFM   112->147 PF00384 * Molybdopterin 7.9e-06 36.1 36/432  
:BLT:SWISS 40->199 FDHA_DESGI 2e-35 47.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55649.1 GT:GENE ACV55649.1 GT:PRODUCT molybdopterin oxidoreductase Fe4S4 region GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1986479..1987078) GB:FROM 1986479 GB:TO 1987078 GB:DIRECTION - GB:PRODUCT molybdopterin oxidoreductase Fe4S4 region GB:NOTE PFAM: molybdopterin oxidoreductase Fe4S4 region; KEGG: gur:Gura_3374 formate dehydrogenase, alpha subunit GB:PROTEIN_ID ACV55649.1 GB:DB_XREF GI:257475329 InterPro:IPR006311 InterPro:IPR006963 LENGTH 199 SQ:AASEQ MNLSRRGFFKAAGAAFATTMAFELSSQSEALAVEPAADWKLVNTEEYTNICCYCSGGCGVICSTRDGELINIEGDPDHPVNQGGLCPKGATMFQLRNVVDPATREVIKNPNRRTRPMVRRPGASEWEDITWDDAVAEIARWVKDTRDATFETVSNGITVNRCHGIASLGGSQQNSEEEYLINKMMRSLGVIAIDNQARV GT:EXON 1|1-199:0| BL:SWS:NREP 1 BL:SWS:REP 40->199|FDHA_DESGI|2e-35|47.0|149/1012| SEG 7->22|gffkaagaafattmaf| BL:PDB:NREP 1 BL:PDB:REP 40->199|1h0hA|7e-36|47.0|149/976| RP:PDB:NREP 1 RP:PDB:REP 50->198|2e7zA|9e-24|21.3|127/727| RP:PFM:NREP 1 RP:PFM:REP 50->94|PF04879|1e-12|48.9|45/55|Molybdop_Fe4S4| HM:PFM:NREP 3 HM:PFM:REP 46->94|PF04879|7.6e-20|51.0|49/55|Molybdop_Fe4S4| HM:PFM:REP 2->21|PF10518|4.3e-06|45.0|20/26|TAT_signal| HM:PFM:REP 112->147|PF00384|7.9e-06|36.1|36/432|Molybdopterin| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF04879|IPR006963| RP:SCP:NREP 1 RP:SCP:REP 39->199|2fug32|8e-31|27.1|129/437|c.81.1.1| HM:SCP:REP 35->199|1h0hA2|1.6e-45|39.0|154/812|c.81.1.1|1/1|Formate dehydrogenase/DMSO reductase, domains 1-3| OP:NHOMO 753 OP:NHOMOORG 400 OP:PATTERN -----121212221222-1111-21-----211-1---1111--11431-----1111-2-------- -22-11--------122----4--23------14441111----1-11------11---------111-1---------25512-----------------1-------------------------1-1-----------111121--------------------------------------------2-1-----------------111----------1------1---1111111111111---11--------------------------------------------------------------------------------------1-----------4---1HD2123-122-------11----------112--1-2---1-----------1-2231121221--21122222222312---212-1--223111111112----1---------------------------------211-1----2223222455533235555243223331-2331-11-1323122432---112----------222-5933123343334-5433312-25545--3521---1111-1-1-------24111--1--11-2----1123212322212231112----521------112313-22222111-2--222222222122-22222-22222-1--21--2----1211-12-12222--1---11111111-------------3--2-111112-1-111--111111-1---211222312-112222-------------1111-11111111111-2122---------2-11---------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 175 STR:RPRED 87.9 SQ:SECSTR ########################cHHHHHHHHHHHHHHHHHccEEEEEEccccTTccEEEEEEcTTccEEEEccccccccTTcccHHHHTHHHHHTccccEGGHHHHcTTcccccEEEccTcccEEEccHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHcGGGEEEEEcGGGTcccTTHHHHHHHHHTcccEEcGGGH DISOP:02AL 199-200| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEcccccccccEEEEEEccEEEEEEcccccccccccccHHHHHHHHHHHHHHHccHHHHccHHHHcccEEEEcccccEEEccHHHHHHHHHHHHHHHHHHHcHHHHHccccccccEEEEEHHccccHHHHHHHHHHHHHHccccccccccc //