[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55650.1
DDBJ      :             selenide, water dikinase
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  337/915 : Eukaryota  81/199 : Viruses  0/175   --->[See Alignment]
d.139.1d.79.4
:351 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->314 2yyeB PDBj 2e-49 38.1 %
:RPS:PDB   27->289 2btuA PDBj 2e-33 18.8 %
:RPS:SCOP  7->159 2yyeA1  d.79.4.1 * 4e-30 49.0 %
:RPS:SCOP  166->267 1t3tA7  d.139.1.1 * 1e-12 13.9 %
:HMM:SCOP  9->162 1cliA1 d.79.4.1 * 5.2e-32 34.4 %
:HMM:SCOP  160->351 1vqvA2 d.139.1.1 * 2.3e-23 35.1 %
:RPS:PFM   50->140 PF00586 * AIRS 2e-05 37.4 %
:RPS:PFM   168->258 PF02769 * AIRS_C 2e-07 38.9 %
:HMM:PFM   168->348 PF02769 * AIRS_C 3.2e-26 33.6 146/151  
:HMM:PFM   49->139 PF00586 * AIRS 8.2e-23 40.7 91/96  
:BLT:SWISS 8->314 SELD_ALKOO 4e-74 46.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55650.1 GT:GENE ACV55650.1 GT:PRODUCT selenide, water dikinase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1987548..1988603 GB:FROM 1987548 GB:TO 1988603 GB:DIRECTION + GB:PRODUCT selenide, water dikinase GB:NOTE Contains selenocysteine; TIGRFAM: selenide, water dikinase; PFAM: AIR synthase related protein; AIR synthase related protein domain protein; KEGG: ppd:Ppro_1707 selenide, water dikinase GB:PROTEIN_ID ACV55650.1 GB:DB_XREF GI:257475330 InterPro:IPR000728 InterPro:IPR004536 InterPro:IPR010918 LENGTH 351 SQ:AASEQ MSETERIRLTRLTEKGGUAAKWGPGDLEEILKDIAPPPDADLLLGFDTSDDAAVYRLNDDTAAVLTLDFFTPVVDDPYEFGAIAAANALSDVFAMGAKPLTALNILAFPCSLGTDVVADVLRGGADKVREAGAFVVGGHSIEDDEPKYGLSVFGTVHPDCIVRNGGAQPGDALFYTKVLGSGIMNSAFRAGFEDDEGMRPVIASMMELNKAGSEAMAAAHVHAATDVTGFGLAGHLHEMLDASDASAELVWDDLPLFEGVYRYSCDFCRPAKTFGIIDWARAFVRQGGLGDEEFENRMGVLCDPQTSGGLLVAVAPDEADEFARAFEAAAGRAPALIGHVRDGAAGEISMK GT:EXON 1|1-351:0| BL:SWS:NREP 1 BL:SWS:REP 8->314|SELD_ALKOO|4e-74|46.9|303/346| SEG 215->224|amaaahvhaa| SEG 315->335|apdeadefarafeaaagrapa| BL:PDB:NREP 1 BL:PDB:REP 7->314|2yyeB|2e-49|38.1|299/343| RP:PDB:NREP 1 RP:PDB:REP 27->289|2btuA|2e-33|18.8|256/322| RP:PFM:NREP 2 RP:PFM:REP 50->140|PF00586|2e-05|37.4|91/97|AIRS| RP:PFM:REP 168->258|PF02769|2e-07|38.9|90/148|AIRS_C| HM:PFM:NREP 2 HM:PFM:REP 168->348|PF02769|3.2e-26|33.6|146/151|AIRS_C| HM:PFM:REP 49->139|PF00586|8.2e-23|40.7|91/96|AIRS| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00586|IPR000728| RP:SCP:NREP 2 RP:SCP:REP 7->159|2yyeA1|4e-30|49.0|149/154|d.79.4.1| RP:SCP:REP 166->267|1t3tA7|1e-12|13.9|101/217|d.139.1.1| HM:SCP:REP 9->162|1cliA1|5.2e-32|34.4|151/0|d.79.4.1|1/1|PurM N-terminal domain-like| HM:SCP:REP 160->351|1vqvA2|2.3e-23|35.1|151/0|d.139.1.1|1/1|PurM C-terminal domain-like| OP:NHOMO 513 OP:NHOMOORG 432 OP:PATTERN ----------------1----------------1-1-112221-----12-211-------------- -11-21---------11-------11-------111--------1-11-------1-----1---11-----------111111----------11------------1----------------------------11-----1112-----11--111--11------11111---1111--------------------------------------------------1--------------------1----------------------------------------------------------------------11--111-1111-1-1---1111--111-112112111-111--1-2---1----1------1-----1---------------1---1--1-1---------------111-111111111-11---------------------------------------------------11--11111111111-11111111-1111111111---11-111112111121----1-------11-11111211111111111-13112121111111-121--111111-1-1-------211-1--11--1-1---11111111111111111111-------------11--11-1111111111-1111111111111111111111--111111111111111111111111111--111111111111-------------1111-111111111-11--1----------1-1111111-1111111-1---------1---2----------11--------------11--------------1---------------------------------------- 11--11--311------------------------------------------------------------------------------------------------11122312231111-11211214E1-228-11-2111--11--11-21112113421111423-11111-11A11111-------1111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 308 STR:RPRED 87.7 SQ:SECSTR ######ccGGGGcccccccccccTTHcTTTTTTTTGGccTTEEcccccEEccTTcccccEEEEEEEEEccTHHHcccccHHHHHHHHHHHHHHTTTcEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHTcEEEEEEEEEcccEEEEEEEEEEEETTcccccTTccTTcEEEEEEccccTTcHHHHHHHHHcccccccHTccccccHHHHHHHHHHccccccEEccTTHHHHHTGGGcHcTTEEEEEcTTcccccHHHHHHHHHHTccHHHHHcHHHTTTccTTEEEcHHHccHHHHHHHHcccccEEEEEE##################################### PSIPRED ccccccEEEEEHHHccccHHHccHHHHHHHHHHHccccccccEEEccccccEEEEEccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccEEHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccEEccEEEEcccEEEEEEEEEEEcccccccccccccccEEEEEccccHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHcccEEEEEHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEEEcHHHHHHHHHHHHHccccEEEEEEEEEEcccEEEEEc //