[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55654.1
DDBJ      :             SirA family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  83/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.114.1d.68.3
:204 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->44 3hz7A PDBj 5e-10 63.4 %
:BLT:PDB   128->173 1qapA PDBj 2e-04 34.8 %
:RPS:PDB   2->70 1dcjA PDBj 8e-13 21.7 %
:RPS:PDB   120->192 2d1pA PDBj 8e-07 24.7 %
:RPS:SCOP  2->70 1pavA  d.68.3.3 * 1e-13 26.1 %
:RPS:SCOP  120->192 2d1pA1  c.114.1.1 * 2e-07 24.7 %
:HMM:SCOP  1->70 1je3A_ d.68.3.3 * 9.4e-16 37.1 %
:HMM:SCOP  104->204 1l1sA_ c.114.1.1 * 2.6e-14 27.7 %
:RPS:PFM   4->48 PF01206 * SirA 4e-06 42.2 %
:HMM:PFM   3->66 PF01206 * SirA 6e-18 37.5 64/70  
:HMM:PFM   133->204 PF02635 * DrsE 1.3e-08 23.9 71/119  
:BLT:SWISS 2->64 Y3061_HALSA 9e-08 36.5 %
:BLT:SWISS 128->173 NADC_SALTY 6e-04 34.8 %
:PROS 4->28|PS01148|UPF0033
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55654.1 GT:GENE ACV55654.1 GT:PRODUCT SirA family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1991126..1991740) GB:FROM 1991126 GB:TO 1991740 GB:DIRECTION - GB:PRODUCT SirA family protein GB:NOTE PFAM: SirA family protein; KEGG: sat:SYN_01072 putative cytoplasmic protein GB:PROTEIN_ID ACV55654.1 GB:DB_XREF GI:257475334 InterPro:IPR001455 LENGTH 204 SQ:AASEQ MEQIDARGQACPLPVVRAKKALSAMGEGVLEVLVDNETAVHNLEALAKTLKVEAVGEKRGEDAFAVTFSKGAAASDGQAGSAASCPAVDPAPTGGRVAVIPSEFMGSGDDELGAVLMKGFVFALTQLDELPETVLMYNGGVKLACTGSSSLDDLRTLAEAGVEIMSCGTCLNHYGLAEQLEVGEATNMYVIVEKQASARGIIRP GT:EXON 1|1-204:0| BL:SWS:NREP 2 BL:SWS:REP 2->64|Y3061_HALSA|9e-08|36.5|63/81| BL:SWS:REP 128->173|NADC_SALTY|6e-04|34.8|46/100| PROS 4->28|PS01148|UPF0033|PDOC00884| SEG 71->84|gaaasdgqagsaas| BL:PDB:NREP 2 BL:PDB:REP 4->44|3hz7A|5e-10|63.4|41/71| BL:PDB:REP 128->173|1qapA|2e-04|34.8|46/289| RP:PDB:NREP 2 RP:PDB:REP 2->70|1dcjA|8e-13|21.7|69/81| RP:PDB:REP 120->192|2d1pA|8e-07|24.7|73/130| RP:PFM:NREP 1 RP:PFM:REP 4->48|PF01206|4e-06|42.2|45/70|SirA| HM:PFM:NREP 2 HM:PFM:REP 3->66|PF01206|6e-18|37.5|64/70|SirA| HM:PFM:REP 133->204|PF02635|1.3e-08|23.9|71/119|DrsE| GO:PFM:NREP 4 GO:PFM GO:0005515|"GO:protein binding"|PF01206|IPR001455| GO:PFM GO:0005737|"GO:cytoplasm"|PF01206|IPR001455| GO:PFM GO:0008033|"GO:tRNA processing"|PF01206|IPR001455| GO:PFM GO:0016783|"GO:sulfurtransferase activity"|PF01206|IPR001455| RP:SCP:NREP 2 RP:SCP:REP 2->70|1pavA|1e-13|26.1|69/78|d.68.3.3| RP:SCP:REP 120->192|2d1pA1|2e-07|24.7|73/128|c.114.1.1| HM:SCP:REP 1->70|1je3A_|9.4e-16|37.1|70/97|d.68.3.3|1/1|SirA-like| HM:SCP:REP 104->204|1l1sA_|2.6e-14|27.7|101/0|c.114.1.1|1/1|DsrEFH-like| OP:NHOMO 87 OP:NHOMOORG 83 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1111------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------11-11111111212-1---1111--11--11-111111-211--1-11--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111-1111111111-11--12-111111111--1--------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 69.6 SQ:SECSTR #EEEccTTccTTHHHHHHHHHHHHccTTcEEEEEccTTHHHHHHHHHHHTTcEEEEEEcccccEEEEEEc#################################################HHHHHHHTTcEEEEEEEcGGGGGGGcTTccccTTcccHHHHccEEEEEHHHHHHTTcccHHHHHHHTcccccc############ DISOP:02AL 204-205| PSIPRED cEEEEcccccccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccEEEEEEEcccEEEEEEEEcccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHccccccEEEEEccccEEEccccHHHHHHHHHHHcccEEEEEccHHHHHccHHHHccccHHHHHHHHHHHHHccccccc //