[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55663.1
DDBJ      :             two component transcriptional regulator, LytTR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  253/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.23.1
:240 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   53->125 2qv0A PDBj 2e-09 35.6 %
:BLT:PDB   145->229 3d6wB PDBj 2e-04 34.2 %
:RPS:PDB   1->131 3cu5A PDBj 5e-09 20.3 %
:RPS:PDB   127->223 3d6wB PDBj 3e-14 23.9 %
:RPS:SCOP  2->119 1p2fA2  c.23.1.1 * 3e-11 29.6 %
:HMM:SCOP  1->121 1s8nA_ c.23.1.1 * 1.6e-19 36.0 %
:RPS:PFM   53->110 PF00072 * Response_reg 3e-06 41.4 %
:RPS:PFM   143->227 PF04397 * LytTR 8e-09 40.0 %
:HMM:PFM   139->213 PF04397 * LytTR 3.1e-17 36.5 74/98  
:HMM:PFM   3->114 PF00072 * Response_reg 5.4e-17 33.3 105/112  
:BLT:SWISS 1->226 LYTT_BACSU 3e-17 30.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55663.1 GT:GENE ACV55663.1 GT:PRODUCT two component transcriptional regulator, LytTR family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2002250..2002972) GB:FROM 2002250 GB:TO 2002972 GB:DIRECTION - GB:PRODUCT two component transcriptional regulator, LytTR family GB:NOTE PFAM: response regulator receiver; LytTr DNA- binding region; SMART: response regulator receiver; KEGG: xop:PXO_04138 two-component system regulatory protein GB:PROTEIN_ID ACV55663.1 GB:DB_XREF GI:257475343 InterPro:IPR001789 InterPro:IPR007492 LENGTH 240 SQ:AASEQ MRIAICDDDGALRSDLRSALDRSLAGRNVRARYQEYTAGERLVADAANGDPFDLVFLDVYLEGVDGVSAARALRAVDAAVPIVFLTVSREHAVESYEVRATDYLMKPLDPAAIERVLDRVLPASEPRLAFRVGASRRYFAFGDIVYLESRDHSVLLHTADGACHRGLAKLDDVQQDLNDPRFLRCHRSCLVNMDYIADVCDDFILRDGTCVPVRVKERRKMHEAYHRYFVDALCEGRAEA GT:EXON 1|1-240:0| BL:SWS:NREP 1 BL:SWS:REP 1->226|LYTT_BACSU|3e-17|30.0|220/241| SEG 69->80|aaralravdaav| BL:PDB:NREP 2 BL:PDB:REP 53->125|2qv0A|2e-09|35.6|73/122| BL:PDB:REP 145->229|3d6wB|2e-04|34.2|76/107| RP:PDB:NREP 2 RP:PDB:REP 1->131|3cu5A|5e-09|20.3|123/124| RP:PDB:REP 127->223|3d6wB|3e-14|23.9|92/107| RP:PFM:NREP 2 RP:PFM:REP 53->110|PF00072|3e-06|41.4|58/111|Response_reg| RP:PFM:REP 143->227|PF04397|8e-09|40.0|80/97|LytTR| HM:PFM:NREP 2 HM:PFM:REP 139->213|PF04397|3.1e-17|36.5|74/98|LytTR| HM:PFM:REP 3->114|PF00072|5.4e-17|33.3|105/112|Response_reg| GO:PFM:NREP 3 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| RP:SCP:NREP 1 RP:SCP:REP 2->119|1p2fA2|3e-11|29.6|108/120|c.23.1.1| HM:SCP:REP 1->121|1s8nA_|1.6e-19|36.0|114/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 316 OP:NHOMOORG 254 OP:PATTERN -------------------------------------------------------------------- -24-1--------------------1-----------1-1-----1--1---11---1--111-1121-111------1122--------1--1------1311-3-532-----------------------------------------------------------------------------------1111111111111111--111111--11--1-1----1----------------------2---11-------11111-1------2221-1----11111111111--------------1-111111--22112222332-2-36--12222-----3A11231-111212-----1----------------------1--------------------------------------------------------------------------------------------------------------------------------------1-1-------1-----11----1---1-1----------11------------111--1--1------------1-------------------1-------------11--------------------1----1--------2111-1-1111111111-1111111111111111111111---11111111111111111111111111----1111111111--------------11------------------------------------------------------------11111---1111111111111111----11------------1-1--------------------------1-11------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 227 STR:RPRED 94.6 SQ:SECSTR cEEEEEcccHHHHHHHHHHccGHcGGccccEEEEEccHHHHHHHHHHHHHccccEEEEcccTTccHHHHHHHHHHHcccccEEEEccTHHHHHHHHHTTccEEEEcHHHHHHHHHHHHHTGGGcccEEEEEccccEEEEEGGGGEEEEEETTEEEEEEcccEEEEEcccHHHHHHHccTTTEEEEETTEEEEGGGEEEEEEEEEETTccEEEE##ccTTTHHHTTHHHH########### PSIPRED cEEEEEcccHHHHHHHHHHHHHcccccEEEEEEEEcccHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHccccccEEEEEcccHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHccccccEEccccEEEEEcccEEEEEEcccEEEEEEEccEEEEEEEEHHHHHHHcccccEEEEEcHHHHHHHHHHHHcccEEEccccEEEEEEHHHHHHHHHHHHHHHHHHHcccccc //