[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55667.1
DDBJ      :             transcriptional regulator, XRE family
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1b.82.1
:183 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   12->165 1zz6A PDBj 1e-07 25.7 %
:RPS:PDB   4->181 2bnoA PDBj 4e-13 20.8 %
:RPS:SCOP  8->70 1perL  a.35.1.2 * 3e-09 21.0 %
:RPS:SCOP  81->181 1vj2A  b.82.1.10 * 3e-11 19.0 %
:HMM:SCOP  3->72 2bnmA1 a.35.1.3 * 2.4e-08 28.6 %
:HMM:SCOP  72->182 2bnmA2 b.82.1.10 * 3.1e-28 40.5 %
:RPS:PFM   127->181 PF07883 * Cupin_2 2e-05 38.2 %
:HMM:PFM   112->180 PF07883 * Cupin_2 7.3e-16 42.6 68/71  
:HMM:PFM   12->66 PF01381 * HTH_3 3.2e-06 27.3 55/55  
:BLT:SWISS 107->178 Y1618_METJA 9e-06 30.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55667.1 GT:GENE ACV55667.1 GT:PRODUCT transcriptional regulator, XRE family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2008044..2008595) GB:FROM 2008044 GB:TO 2008595 GB:DIRECTION - GB:PRODUCT transcriptional regulator, XRE family GB:NOTE PFAM: Cupin 2 conserved barrel domain protein; KEGG: pca:Pcar_1243 transcriptional regulator GB:PROTEIN_ID ACV55667.1 GB:DB_XREF GI:257475347 InterPro:IPR001387 InterPro:IPR013096 LENGTH 183 SQ:AASEQ MVAELAEIGLRIKGLREACDVSREDMAAELEVPLETYVRWEETGDDVPISAIYHMAHHFGVEFTEILTGTAAKLDTYQVVRWGEGREVDRYPGYHFEDLAWRYTGKIMQPLLVVLDPSDEPAKLVTHTGQEFNLVIEGTVVVTWADKEFELNAGDSIYFNPEHPHGQRCGGDIPAKFVTIIAE GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 107->178|Y1618_METJA|9e-06|30.6|72/125| BL:PDB:NREP 1 BL:PDB:REP 12->165|1zz6A|1e-07|25.7|152/181| RP:PDB:NREP 1 RP:PDB:REP 4->181|2bnoA|4e-13|20.8|178/191| RP:PFM:NREP 1 RP:PFM:REP 127->181|PF07883|2e-05|38.2|55/70|Cupin_2| HM:PFM:NREP 2 HM:PFM:REP 112->180|PF07883|7.3e-16|42.6|68/71|Cupin_2| HM:PFM:REP 12->66|PF01381|3.2e-06|27.3|55/55|HTH_3| RP:SCP:NREP 2 RP:SCP:REP 8->70|1perL|3e-09|21.0|62/63|a.35.1.2| RP:SCP:REP 81->181|1vj2A|3e-11|19.0|100/114|b.82.1.10| HM:SCP:REP 3->72|2bnmA1|2.4e-08|28.6|70/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| HM:SCP:REP 72->182|2bnmA2|3.1e-28|40.5|111/0|b.82.1.10|1/1|RmlC-like cupins| OP:NHOMO 93 OP:NHOMOORG 71 OP:PATTERN --------------------------------112---12222-----11221--------------- ------------------------------------1-11---------------------------------------1221-----1111-1------------------------------------------111--------------------------------------------------------------------------------1------------1-----------------------------------------------------------------------------------------------1-11111---2---------1-------------------------------------------2--------------------------1--21111111111-1-----------1------------------------------------------------------------------------------------11--------------2-----1-1-----------------3--221-22112-------12--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHTTcTTccHHHHHHHHHHTTccTGGGcccccccccTTcccccGGGccEEcccTTEEEEEcTTcTTcEEEEEEEccccGGGccccccccccEEEEEEEccEEEEEccEEEEEcTTcEEEEcTTccEEEEEcTTcccEEEEEEHH PSIPRED cHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHccccccccccEEEEcccccEEcccccEEEEHHccccccccEEEEEEEEccccccccccccccEEEEEEEEEEEEEEEccEEEEEccccEEEEcccccEEEEEcccccEEEEEEEEc //