[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55680.1
DDBJ      :             protein of unknown function DUF107
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   82->140 3cp0A PDBj 3e-07 32.1 %
:RPS:PFM   82->138 PF01957 * NfeD 2e-06 50.9 %
:HMM:PFM   5->140 PF01957 * NfeD 1.9e-16 25.6 129/144  
:BLT:SWISS 82->139 Y826_METJA 5e-05 42.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55680.1 GT:GENE ACV55680.1 GT:PRODUCT protein of unknown function DUF107 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2020507..2020935) GB:FROM 2020507 GB:TO 2020935 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF107 GB:NOTE PFAM: protein of unknown function DUF107; KEGG: sfu:Sfum_2309 protein of unknown function DUF107 GB:PROTEIN_ID ACV55680.1 GB:DB_XREF GI:257475360 InterPro:IPR002810 LENGTH 142 SQ:AASEQ MSPFIWLAVAAVMAVVEVVSFGLITMWFVIGALAAFAANLLGADLLVQIVVFLVVSVVCLVALRPVFVKYRDRGKQEEPTHVGQTAVVVEDVDNEGLTGRVETDNRMTWAARSADGSFIPQGAVVRIVGQESVKLIVERKVS GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 82->139|Y826_METJA|5e-05|42.6|54/100| TM:NTM 2 TM:REGION 10->32| TM:REGION 45->67| SEG 8->19|avaavmavvevv| SEG 32->66|alaafaanllgadllvqivvflvvsvvclvalrpv| RP:PDB:NREP 1 RP:PDB:REP 82->140|3cp0A|3e-07|32.1|56/62| RP:PFM:NREP 1 RP:PFM:REP 82->138|PF01957|2e-06|50.9|53/138|NfeD| HM:PFM:NREP 1 HM:PFM:REP 5->140|PF01957|1.9e-16|25.6|129/144|NfeD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 56 STR:RPRED 39.4 SQ:SECSTR #################################################################################TTcEEEEEEccccc##ccEEEETTE#EEEEEEcTTccccTTcEEEEEEEETTEEEEEEc## DISOP:02AL 57-76| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcccEEEEEccccccccEEEEEEccEEEEEEEcccccccccccEEEEEEEccEEEEEEEEcc //