[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55708.1
DDBJ      :             two component transcriptional regulator, LuxR family
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  728/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->183 1a04A PDBj 3e-26 33.1 %
:BLT:PDB   155->212 2jpcA PDBj 6e-09 39.7 %
:RPS:PDB   1->211 3c3wB PDBj 8e-37 35.4 %
:RPS:SCOP  2->195 1s8nA  c.23.1.1 * 2e-21 22.5 %
:RPS:SCOP  166->214 1fseF  a.4.6.2 * 3e-14 32.7 %
:HMM:SCOP  1->138 1a04A2 c.23.1.1 * 1.8e-28 31.4 %
:HMM:SCOP  130->216 1p4wA_ a.4.6.2 * 1.1e-21 40.2 %
:RPS:PFM   4->116 PF00072 * Response_reg 4e-12 33.6 %
:RPS:PFM   152->206 PF00196 * GerE 3e-13 54.5 %
:HMM:PFM   4->116 PF00072 * Response_reg 7.2e-27 34.2 111/112  
:HMM:PFM   150->206 PF00196 * GerE 7.1e-24 49.1 57/58  
:BLT:SWISS 2->213 NREC_STACT 6e-63 54.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55708.1 GT:GENE ACV55708.1 GT:PRODUCT two component transcriptional regulator, LuxR family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2050958..2051602) GB:FROM 2050958 GB:TO 2051602 GB:DIRECTION - GB:PRODUCT two component transcriptional regulator, LuxR family GB:NOTE PFAM: response regulator receiver; regulatory protein LuxR; SMART: response regulator receiver; regulatory protein LuxR; KEGG: hch:HCH_00419 response regulator GB:PROTEIN_ID ACV55708.1 GB:DB_XREF GI:257475388 InterPro:IPR000792 InterPro:IPR001789 LENGTH 214 SQ:AASEQ MIRVMLADDHEVVRAGFRMILEQDPDVRVVAEAADGAQAYAIVAREKPDILLMDISMPPGQSGLVACEKIAKDFPGTKVVILTMFAEPEYLFYTLRGGAAGYVLKNSTSEELIAAVHAVAEGGSYIHPKMTAMLTKQLVAGGEEEDRSYQQLSNRELEILQLLAKGFTNKEISEQIFLSVKTVEAHRSKIYQKLGLKTRADLVDYALRHKLLNV GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 2->213|NREC_STACT|6e-63|54.2|212/217| BL:PDB:NREP 2 BL:PDB:REP 4->183|1a04A|3e-26|33.1|172/205| BL:PDB:REP 155->212|2jpcA|6e-09|39.7|58/61| RP:PDB:NREP 1 RP:PDB:REP 1->211|3c3wB|8e-37|35.4|209/210| RP:PFM:NREP 2 RP:PFM:REP 4->116|PF00072|4e-12|33.6|110/111|Response_reg| RP:PFM:REP 152->206|PF00196|3e-13|54.5|55/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 4->116|PF00072|7.2e-27|34.2|111/112|Response_reg| HM:PFM:REP 150->206|PF00196|7.1e-24|49.1|57/58|GerE| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 2->195|1s8nA|2e-21|22.5|187/190|c.23.1.1| RP:SCP:REP 166->214|1fseF|3e-14|32.7|49/50|a.4.6.2| HM:SCP:REP 1->138|1a04A2|1.8e-28|31.4|137/0|c.23.1.1|1/1|CheY-like| HM:SCP:REP 130->216|1p4wA_|1.1e-21|40.2|87/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 4425 OP:NHOMOORG 752 OP:PATTERN -----------------------1------11---2--11-11---11---11-2-2121-------- CEF3n85655532465533-36116E333334D888EKHI7G8bGPB66CA9798857118AJ7dFPZldC5333B44-3519--1--3321-222---6-8234M4N33-------------------1------DDEDC779IAB68A66444--221232564EEDF11222111312116763212259B66666899596688ABACC6A8A8487B533554555MW444444434444444344432---22-1--1221222221-1-11112223234332222222222222222222222225332222232692862222332222821131228444-C212-A936613624311511-7312112-----17G6B2145467722222222223-87678BA7386-533472446478311235133423434---------1112B55------------------------------1241-54345D78BD899885BBHNCCCD5C9EGEILL12FHDEE977DACEH45B48968761111111-15A8B38613272183446-438726725334435531-1---------------------3--87175486642777893868987675A787---1432------85455758A96975799-A999867878A7977877555567766A99AAAAAAA99A9AA788777773-B77777677777--4344444111113A4311111211111-223222222221243EEFEAHAEAAAC86A99---------124464555538447DDA8B876672222112-552222--------2---------------------------1--1-1-1-13R- -----------------------------------------------------------------------------------------------------1-------------------------------------------------------------2---------2-----------2--5---1-2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 214 STR:RPRED 100.0 SQ:SECSTR cEEEEEEcccHHHHHHHHHHHHTcTTEEEEEEEccHHHHHHHHHHHcccEEEEccEETTEEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHHHccTTTTTccHHHHHHHHHHTTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHTcHHH DISOP:02AL 214-215| PSIPRED ccEEEEEccHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccHHcccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccc //