[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55717.1
DDBJ      :             cation diffusion facilitator family transporter
Swiss-Prot:             

Homologs  Archaea  39/68 : Bacteria  644/915 : Eukaryota  36/199 : Viruses  0/175   --->[See Alignment]
d.52.9f.59.1
:301 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   43->295 2qfiA PDBj 6e-24 26.8 %
:RPS:PDB   234->300 3byrA PDBj 4e-12 28.8 %
:RPS:SCOP  16->217 2qfiA2  f.59.1.1 * 1e-27 21.9 %
:RPS:SCOP  224->295 2qfiA1  d.52.9.1 * 1e-13 29.6 %
:RPS:PFM   38->283 PF01545 * Cation_efflux 9e-18 29.8 %
:HMM:PFM   22->299 PF01545 * Cation_efflux 1.3e-62 30.1 276/285  
:BLT:SWISS 36->279 YDBO_BACSU 4e-27 29.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55717.1 GT:GENE ACV55717.1 GT:PRODUCT cation diffusion facilitator family transporter GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2058627..2059532) GB:FROM 2058627 GB:TO 2059532 GB:DIRECTION - GB:PRODUCT cation diffusion facilitator family transporter GB:NOTE TIGRFAM: cation diffusion facilitator family transporter; PFAM: cation efflux protein; KEGG: mxa:MXAN_3043 cation efflux family protein GB:PROTEIN_ID ACV55717.1 GB:DB_XREF GI:257475397 InterPro:IPR002524 LENGTH 301 SQ:AASEQ MAKALATKNPVSERMRSIRRVLWVILVLNLAVAAAKYVYGLMSGSASMQADGIHSVFDSAGNVVGLVGIALAARPADDSHPYGHAKFETYASLVIGVLLLLAAFEVGSSAVGKLVSGVYTAEVTPVSFIVMVGTLAVNIGVTTYERRCAKRLKSEVLAADANHTLSDALVSIGVIVGLAAVALGFPMADPIMALVVTVAILATAYDVFKHALATLSDHARIPDKDVQAVAMGVPGVQDAHHIRTRGTEGEVYADLHVLVAPGMTVGEAHELSERVERAIMQRFPNVIEVLVHIEPNDGHED GT:EXON 1|1-301:0| BL:SWS:NREP 1 BL:SWS:REP 36->279|YDBO_BACSU|4e-27|29.7|239/290| TM:NTM 6 TM:REGION 21->43| TM:REGION 55->76| TM:REGION 90->112| TM:REGION 122->144| TM:REGION 165->187| TM:REGION 192->214| SEG 21->35|vlwvilvlnlavaaa| SEG 193->204|alvvtvailata| BL:PDB:NREP 1 BL:PDB:REP 43->295|2qfiA|6e-24|26.8|250/286| RP:PDB:NREP 1 RP:PDB:REP 234->300|3byrA|4e-12|28.8|66/89| RP:PFM:NREP 1 RP:PFM:REP 38->283|PF01545|9e-18|29.8|238/282|Cation_efflux| HM:PFM:NREP 1 HM:PFM:REP 22->299|PF01545|1.3e-62|30.1|276/285|Cation_efflux| GO:PFM:NREP 4 GO:PFM GO:0006812|"GO:cation transport"|PF01545|IPR002524| GO:PFM GO:0008324|"GO:cation transmembrane transporter activity"|PF01545|IPR002524| GO:PFM GO:0016020|"GO:membrane"|PF01545|IPR002524| GO:PFM GO:0055085|"GO:transmembrane transport"|PF01545|IPR002524| RP:SCP:NREP 2 RP:SCP:REP 16->217|2qfiA2|1e-27|21.9|201/204|f.59.1.1| RP:SCP:REP 224->295|2qfiA1|1e-13|29.6|71/82|d.52.9.1| OP:NHOMO 884 OP:NHOMOORG 719 OP:PATTERN --1-------------21-----21111111-112111111111213-12665112--111---1--1 112--1--11-----1-11-11--1-1111113111-111------1---1-1-------------11----------1311111111--11-111---111-1-11-11---------------12112-121--1111111111311111111111111111111112-------------111--11-12522222232222222212112322212221112222222221111111111111121122111-11---------------1-111111111111111111111111111111111111111-1111111121353333333232131121221211121111111211111111111-111-11111111111122112111111111-111111-111111121111111122-2111-111----11-11-1-11111111-1111511----------111111111111111-----11--------2111112111111111111121211211-12611111111-1----21---11------1-1-1121121--1-12111--2112123221-1-1-121121-111111---------1121211321-1111111111111111111--11111--11121------11112111111111111-111111111111111111132211--11111111111111111111111111-111111111111----111111111111-1111-111----1111----------1-11111111111112111111111111111111111111111--------------1131--------------1-1-------------------------1111211111111 --------1----11----1111111111----111--------------------------------1--1---11-21-------------1---------2-1---------------------------------------------------------1------1---1----------21-1-21111---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 85.0 SQ:SECSTR ##########################################TTcccccccccTTHHHHHHHHHHHHHHTTccccccTTccccccTHHHHHHHTTTTTTcccTTGGGcccTTccTTTccccT#TTccccccGGGcccGGGGTTTHHHHGGGcccTTcGGGGGGHHHHTccccTTcccTTcccccTTccccccHHHHTTTTTTTTTTHHHHTGGGccccc#ccHHHHHHHHHHTTTccEEEEEEEEEETTEEEEEEEEEccTTccHHHHHHHHHHHHHHHHHHcTcTEEEEEEEEcGGGcc# PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccc //