[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55725.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:181 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   87->140 PF07210 * DUF1416 0.00071 28.3 53/86  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55725.1 GT:GENE ACV55725.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2065216..2065761) GB:FROM 2065216 GB:TO 2065761 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55725.1 GB:DB_XREF GI:257475405 LENGTH 181 SQ:AASEQ MLKIVSEALAHKTFVWMPLFETRGGQSTLVSFVFIFLFVFALSAPLVEIIRYTSDAVSVASASNDVARAVAENPSMSEGERMDFFNRAYPNLAGANVEVTIGFPRSEEYQHHLPSADGTWNVRPSKTTSREVDVEVSIDRPWVTPLSSIILAITGTGLGDSYHIEAGGSACIDDTVSSGSW GT:EXON 1|1-181:0| TM:NTM 1 TM:REGION 27->49| SEG 27->43|stlvsfvfiflfvfals| SEG 54->71|sdavsvasasndvarava| HM:PFM:NREP 1 HM:PFM:REP 87->140|PF07210|0.00071|28.3|53/86|DUF1416| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-31,34-34,39-39,151-151| PSIPRED cHHHHHHHHcccEEEEEEEEEcccccHHHHHHHHHHHHHHHHccHHHHHHHHccccEEEEccccHHHHHHHcccccccccEEHHHHHHcccccccEEEEEEEccccHHHHHHcccccccEEEccccccccEEEEEEEEcccccccHHHHHEEEEccccccEEEEEcccccHHHcccccccc //