[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55734.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->61 PF02027 * RolB_RolC 6.7e-05 23.5 51/185  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55734.1 GT:GENE ACV55734.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2075202..2075390) GB:FROM 2075202 GB:TO 2075390 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55734.1 GB:DB_XREF GI:257475414 LENGTH 62 SQ:AASEQ MLDPEAIACLDEICQARNCYSDLMKSSFTHNQSQAVRDAINLLYRFEVGKESLVHDEDPRYM GT:EXON 1|1-62:0| HM:PFM:NREP 1 HM:PFM:REP 11->61|PF02027|6.7e-05|23.5|51/185|RolB_RolC| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHccccccccc //