[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55738.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:201 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   59->115 PF01656 * CbiA 0.0002 16.7 48/194  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55738.1 GT:GENE ACV55738.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2079476..2080081 GB:FROM 2079476 GB:TO 2080081 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55738.1 GB:DB_XREF GI:257475418 LENGTH 201 SQ:AASEQ MAASLWLASLGYKTCFVFSDKMQFTSMRAALDVSDLTNGSYRFERCDFYYWSKESSYIGLYDYVIIDCGTLMFSNHSKSYMKEQFCKADVSIMCASGAPWNVYLIAETLKMIQAKELIRWRWFFTDATAGFIREIKPAFDNLKKRLSHTTEFKHLYLLDNTSALDSSDEVPSLEQALYNVLPTGLRNTIRKQNYGNDPERE GT:EXON 1|1-201:0| HM:PFM:NREP 1 HM:PFM:REP 59->115|PF01656|0.0002|16.7|48/194|CbiA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-25,31-31,39-39,48-48,53-54,59-60,62-62,67-67,81-81,87-88,90-90,95-96,101-102,104-104,109-109,157-157,160-160,188-188| PSIPRED cccHHHHHHccccEEEEEEcccHHHHHHHHccHHHcccccEEEEEEEEEEEEccccEEEEEEEEEEEEcEEEEccccHHHHHHHHHHccEEEEEcccccEEEEEHHHHHHHHHHHHEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccHHHHHHHHHccHHHHHHHHHHccccccccc //