[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55752.1
DDBJ      :             protein of unknown function DUF340 membrane
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  161/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:314 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   139->310 PF03956 * DUF340 1e-26 45.0 %
:HMM:PFM   3->85 PF03956 * DUF340 0.00017 23.8 80/191  
:HMM:PFM   121->311 PF03956 * DUF340 2.3e-56 43.9 189/191  
:BLT:SWISS 178->310 YBJE_ECOLI 2e-20 37.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55752.1 GT:GENE ACV55752.1 GT:PRODUCT protein of unknown function DUF340 membrane GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2096129..2097073) GB:FROM 2096129 GB:TO 2097073 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF340 membrane GB:NOTE PFAM: protein of unknown function DUF340 membrane; KEGG: mmw:Mmwyl1_0847 protein of unknown function DUF340 membrane GB:PROTEIN_ID ACV55752.1 GB:DB_XREF GI:257475432 InterPro:IPR005642 LENGTH 314 SQ:AASEQ MEILAVMAAGVLVGATVFPARLKGLNEKLTLAATGLLIFSMGVLLAGRDSFLEELGQVGWASILFCLVPVAFSTIAVYALTNLFMSDIARRPAGRHVSAAQDDAEGGADARGETVMIGVAVGALSLGAAYGLSGVSLAPVDLVADHSEAVLYALMFFVGISVGGSRGLLGKLRQYHVRVLIIPAGIVAGSVLGGLVCAPLAGMSLPTGAAVASGLGWYSLAGVMMTDIAGAQVGSITFLANLLRELVSFFSIPWIAKHLNYPTCIAPAGATSEDTTLPMLIRCTNGETVVLSVLNGVICSALVPVLIEAFHQFM GT:EXON 1|1-314:0| BL:SWS:NREP 1 BL:SWS:REP 178->310|YBJE_ECOLI|2e-20|37.9|132/299| TM:NTM 9 TM:REGION 1->21| TM:REGION 31->53| TM:REGION 62->84| TM:REGION 117->139| TM:REGION 145->167| TM:REGION 178->200| TM:REGION 206->228| TM:REGION 234->256| TM:REGION 289->311| SEG 4->17|lavmaagvlvgatv| SEG 99->112|aaqddaeggadarg| SEG 118->138|gvavgalslgaayglsgvsla| RP:PFM:NREP 1 RP:PFM:REP 139->310|PF03956|1e-26|45.0|171/190|DUF340| HM:PFM:NREP 2 HM:PFM:REP 3->85|PF03956|0.00017|23.8|80/191|DUF340| HM:PFM:REP 121->311|PF03956|2.3e-56|43.9|189/191|DUF340| OP:NHOMO 189 OP:NHOMOORG 182 OP:PATTERN ------11------1111--11----------------11111-----------1111111---1--- --------------------------------------------------------------------------------11------2122-2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---111111-1---------2---------11-1--111------1------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------1111111-----------1-11--1111--------------------------------------------11--1--------------------------------------11--11-1111111111-1111111111111111111111112111111111111111111111111111-111111111111----------------11111111--1--11111111111111-------------------1---------11111111111111------------------------------------------------------------1-1---1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 314-315| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccHHHHHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHHHHHHHHHc //