[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55756.1
DDBJ      :             D-alanyl carrier protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:81 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->78 1dv5A PDBj 2e-14 44.0 %
:RPS:PDB   4->78 1dv5A PDBj 1e-07 44.0 %
:RPS:SCOP  4->78 1dv5A  a.28.1.3 * 4e-15 44.0 %
:HMM:SCOP  2->81 1dv5A_ a.28.1.3 * 2.7e-12 40.0 %
:HMM:PFM   9->74 PF00550 * PP-binding 6.9e-14 44.3 61/67  
:BLT:SWISS 5->77 DLTC_BACA2 3e-16 47.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55756.1 GT:GENE ACV55756.1 GT:PRODUCT D-alanyl carrier protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2100326..2100571) GB:FROM 2100326 GB:TO 2100571 GB:DIRECTION - GB:PRODUCT D-alanyl carrier protein GB:NOTE TIGRFAM: D-alanyl carrier protein; PFAM: phosphopantetheine-binding; KEGG: bsu:BSU38520 D-alanine--poly(phosphoribitol) ligase subunit 2 GB:PROTEIN_ID ACV55756.1 GB:DB_XREF GI:257475436 InterPro:IPR003230 InterPro:IPR006163 LENGTH 81 SQ:AASEQ MTYEELEEKMLDILEEVCGDDEVRTNRDEDLFALGLLDSMGAIELLVDIEDVFGVYIAPTEVERDEMNTVNLIIHQVEIRL GT:EXON 1|1-81:0| BL:SWS:NREP 1 BL:SWS:REP 5->77|DLTC_BACA2|3e-16|47.9|73/78| BL:PDB:NREP 1 BL:PDB:REP 4->78|1dv5A|2e-14|44.0|75/80| RP:PDB:NREP 1 RP:PDB:REP 4->78|1dv5A|1e-07|44.0|75/80| HM:PFM:NREP 1 HM:PFM:REP 9->74|PF00550|6.9e-14|44.3|61/67|PP-binding| RP:SCP:NREP 1 RP:SCP:REP 4->78|1dv5A|4e-15|44.0|75/80|a.28.1.3| HM:SCP:REP 2->81|1dv5A_|2.7e-12|40.0|80/80|a.28.1.3|1/1|ACP-like| OP:NHOMO 89 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------1111111121111111--1111111---1--------------------------1----1--1111----11--11-1-11-111---11111111111111111111111111111111111111111----1-------1-1-1----------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHHHHHHHTcccTTTcccccccTTcccccHHHHHHHHHHTTTcccccccccccTTTTTcHHHHHHHHHHHH PSIPRED ccHHHHHHHHHHHHHHHHccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHccHHHHHHHHHHHHc //