[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55778.1
DDBJ      :             protein of unknown function DUF150
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  454/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.38.2d.52.4
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->98 1ib8A PDBj 6e-11 32.9 %
:RPS:SCOP  8->84 1ib8A2  d.52.4.1 * 5e-14 24.7 %
:RPS:SCOP  85->147 1ib8A1  b.38.2.1 * 7e-08 22.2 %
:HMM:SCOP  1->84 1ib8A2 d.52.4.1 * 4e-18 41.0 %
:HMM:SCOP  85->153 1ib8A1 b.38.2.1 * 8.4e-13 39.1 %
:RPS:PFM   13->147 PF02576 * DUF150 3e-21 38.5 %
:HMM:PFM   13->147 PF02576 * DUF150 4.5e-39 40.0 135/141  
:BLT:SWISS 8->156 RIMP_THISH 2e-23 36.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55778.1 GT:GENE ACV55778.1 GT:PRODUCT protein of unknown function DUF150 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2128043..2128522) GB:FROM 2128043 GB:TO 2128522 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF150 GB:NOTE PFAM: protein of unknown function DUF150; KEGG: tgr:Tgr7_1001 protein of unknown function DUF150 GB:PROTEIN_ID ACV55778.1 GB:DB_XREF GI:257475458 InterPro:IPR003728 LENGTH 159 SQ:AASEQ MLSKKEQQLLDALAPRAEQEGVEIVTVEVAGAKKAPTIRVYIDTPDGVSFDELSSAQAWINDLMDELDPFPGAYTLEVSSPGIDRPLRTAEHFARFVGDTAVLKTQPVDGRGSWTGAIASVEGDVVVLDVDGAEARIPMDTIKRAHLKGTIDFGSQTSI GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 8->156|RIMP_THISH|2e-23|36.2|149/154| SEG 121->135|vegdvvvldvdgaea| BL:PDB:NREP 1 BL:PDB:REP 23->98|1ib8A|6e-11|32.9|76/164| RP:PFM:NREP 1 RP:PFM:REP 13->147|PF02576|3e-21|38.5|135/138|DUF150| HM:PFM:NREP 1 HM:PFM:REP 13->147|PF02576|4.5e-39|40.0|135/141|DUF150| RP:SCP:NREP 2 RP:SCP:REP 8->84|1ib8A2|5e-14|24.7|77/90|d.52.4.1| RP:SCP:REP 85->147|1ib8A1|7e-08|22.2|63/74|b.38.2.1| HM:SCP:REP 1->84|1ib8A2|4e-18|41.0|83/90|d.52.4.1|1/1|YhbC-like, N-terminal domain| HM:SCP:REP 85->153|1ib8A1|8.4e-13|39.1|69/0|b.38.2.1|1/1|YhbC-like, C-terminal domain| OP:NHOMO 455 OP:NHOMOORG 454 OP:PATTERN -------------------------------------------------------------------- -11-----------1----------1------1-------1-------1------1------1----1-1--------1111---111--------------------1--------------------------------------11-11--------------111-------------------111111111111111111111111111111111111111111111111111111111111111111-1-----1--11-----11-1-111--1----1---------------1----------111111111-111111111111-1-11111111111--11-1111111-11111111----1-1-11------------11-1------------1-11111111--1-------1----11111-11111111111111111111111111--------------11----------------111-----------------------------------------------------1-1--1111111-------1111111-------1-11-111111111111-111-----------------11--11111111111111111111111111111111---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1111111111111111111111111111111111111----1111111111111111111---------11111111111111111111111111111111------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 47.8 SQ:SECSTR ######################EEEEEEEEEETTEEEEEEEEEccccccHHHHHHHHHHHGGGTTTcccccccEEEEEEccccccccccHHHHHHHcc############################################################# DISOP:02AL 159-160| PSIPRED cccHHHHHHHHHHHHHHHHcccEEEEEEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccHHHHHHHcccEEEEEEEEcccEEEEEEEEEEEEccEEEEEEccEEEEEEHHHHHEEEEEEEEEccccccc //