[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55792.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:331 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  229->319 1cw0A_ c.52.1.15 * 0.00091 19.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55792.1 GT:GENE ACV55792.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2148319..2149314 GB:FROM 2148319 GB:TO 2149314 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55792.1 GB:DB_XREF GI:257475472 LENGTH 331 SQ:AASEQ MNRYLSHTSALEWLAYAKADPLAPAAADRRERLPRHDGTPLPPAGKTTRADVDGLASFGLGYLAKPVHLLVPSSECRIRCADARCHVRSGPFPARSFLPIDEGTFSSSPELAFVQMAEVLDCPRLVKLGDELCGIYGIETVGIVDFDRTSPFTTVKRLGRFLLKAECMPGLVKARKAVRHIAPGSASPMETAIVLLLCLPPRLGGYGLPRPVMNGRASLKKQACRKPSDRRYRCDLLWPAADIAVEYDSFLHHGSRAKMADDARRRNDLLARGTTVVSITGRTVWNLIELDEIARLLARRMGKRLSTNGVGWRKAQHELHGMLTGSFFDER GT:EXON 1|1-331:0| SEG 14->35|layakadplapaaadrrerlpr| SEG 195->211|lllclpprlggyglprp| SEG 260->272|addarrrndllar| HM:SCP:REP 229->319|1cw0A_|0.00091|19.8|91/155|c.52.1.15|1/1|Restriction endonuclease-like| OP:NHOMO 14 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------D1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 53-53,55-76,330-332| PSIPRED cccHHHHHHHHHHHHHHccccccccccHHHHHccccccccccccccccHHHHHHHHHHcHHHHcccEEEEEcccccEEEccccEEEEEcccccHHccccccccEEEccHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccccHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccHHHHHHHHcccccccccccccEEEEEEEccHHHccccccEEEEEEcccHHHcEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccc //